Property Summary

NCBI Gene PubMed Count 17
PubMed Score 40.85
PubTator Score 17.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 2.895 4.5e-08
medulloblastoma, large-cell -1.400 6.8e-04
juvenile dermatomyositis 1.009 1.6e-03
pancreatic ductal adenocarcinoma liver m... -1.651 8.3e-04
Pick disease 1.300 1.8e-05
ovarian cancer -1.800 5.2e-09

Gene RIF (3)

PMID Text
24025447 Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19349195 These results suggest that ARIP2 is a putative growth-promoting factor involved in breast tumorigenesis and tumor development.

AA Sequence

MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNG      1 - 70
QDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMR     71 - 140
YRQQL                                                                     141 - 145
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24025447 2013 Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19349195 2009 Identification and characterization of human ARIP2 and its relation to breast cancer.
18845145 2008 The mitochondrial outer membrane protein hFis1 regulates mitochondrial morphology and fission through self-interaction.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451561 2004 Novel factors in regulation of activin signaling.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11882656 2002 Regulation of endocytosis of activin type II receptors by a novel PDZ protein through Ral/Ral-binding protein 1-dependent pathway.
11696420 2001 Myopodin, a synaptopodin homologue, is frequently deleted in invasive prostate cancers.
11673475 2001 Differentiation- and stress-dependent nuclear cytoplasmic redistribution of myopodin, a novel actin-bundling protein.
10827173 2000 Interactions of the low density lipoprotein receptor gene family with cytosolic adaptor and scaffold proteins suggest diverse biological functions in cellular communication and signal transduction.
10357812 1999 Recruitment of an alternatively spliced form of synaptojanin 2 to mitochondria by the interaction with the PDZ domain of a mitochondrial outer membrane protein.