Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.59
PubTator Score 2.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -3.800 1.8e-07
astrocytic glioma -3.200 3.1e-03
Astrocytoma, Pilocytic -3.600 1.7e-11
atypical teratoid / rhabdoid tumor -4.300 7.7e-09
Breast cancer 1.100 1.2e-03
ependymoma -3.500 7.1e-03
glioblastoma -3.600 5.4e-10
group 3 medulloblastoma -3.700 1.3e-04
intraductal papillary-mucinous neoplasm ... 2.300 1.6e-02
invasive ductal carcinoma 1.400 1.6e-03
medulloblastoma, large-cell -4.900 2.1e-06
non-small cell lung cancer 1.059 3.8e-07
oligodendroglioma -2.300 2.3e-02
Pick disease -1.600 2.1e-02
primitive neuroectodermal tumor -2.200 2.4e-02
severe Alzheimer's disease -1.473 3.0e-02
spina bifida -1.072 3.7e-02
tuberculosis -1.600 3.1e-07

Gene RIF (2)

AA Sequence

MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVFGPIVNEGYVNTDSGPELRCVFNGNAGACRF      1 - 70
GVALGLGAFLACAAFLLLDVRFQQISSVRDRRRAVLLDLGFSGLWSFLWFVGFCFLTNQWQRTAPGPATT     71 - 140
QAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQS    141 - 210
PPFTETLDTSPKGYQVPAY                                                       211 - 229
//

Text Mined References (10)

PMID Year Title