Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.59
PubTator Score 11.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
urothelial carcinoma -1.100 9.5e-03
astrocytoma -1.700 5.6e-26
posterior fossa group B ependymoma -2.500 1.1e-14
esophageal adenocarcinoma -1.700 1.8e-02
psoriasis -1.100 3.4e-11
cutaneous lupus erythematosus -1.200 4.4e-03
glioblastoma -2.600 1.8e-07
oligodendroglioma -1.600 2.5e-20
osteosarcoma -2.592 2.8e-05
group 3 medulloblastoma 1.900 3.0e-04
atypical teratoid / rhabdoid tumor -2.900 2.9e-14
medulloblastoma, large-cell -2.200 2.4e-05
primitive neuroectodermal tumor -1.500 1.5e-04
intraductal papillary-mucinous adenoma (... -2.400 1.1e-05
intraductal papillary-mucinous carcinoma... -2.000 3.1e-04
intraductal papillary-mucinous neoplasm ... -2.100 2.5e-03
interstitial cystitis -1.100 5.9e-04
pediatric high grade glioma -2.500 1.7e-09
pilocytic astrocytoma -1.700 6.8e-09
subependymal giant cell astrocytoma -2.928 2.1e-02
nasopharyngeal carcinoma -1.100 1.4e-03
spina bifida -1.130 3.6e-02
Pick disease -1.400 1.7e-03
ovarian cancer -1.900 8.8e-09
pituitary cancer 1.800 1.7e-07

Gene RIF (9)

PMID Text
22675529 SYNGR1 was soluble and stable in a variety of mild detergents and multiple biophysical methods confirmed the folded state of the protein.
19665806 A case-control study with synaptogyrin 1 was conducted in 506 bipolar disorder patients and 507 healthy individuals from the Han Chinese population. No association was found in this study.
19665806 Observational study of gene-disease association. (HuGE Navigator)
19641478 The results of association study support a contribution of SYNGR1 to schizophrenia susceptibility.
19641478 Observational study of gene-disease association. (HuGE Navigator)
17049558 These mutations were not found in 507 control subjects, suggesting further functional assays are warranted to verify their relevance to the pathogenesis of schizophrenia.
16215643 Observational study of gene-disease association. (HuGE Navigator)
16215643 Our results support SYNGR1 as a probable susceptibility gene for schizophrenia and bipolar disorder.
14732601 This research found a novel nonsense mutation (Trp27Ter) in exon 2 of the SYNGR1 gene in a family multiply affected with schizophrenia. And expressed in the brain.

AA Sequence

MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSY      1 - 70
GVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPL     71 - 140
NEGTDAARAAIAFSFFSIFTWAGQAVLAFQRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPTGPDPAGM    141 - 210
GGTYQQPANTFDTEPQGYQSQGY                                                   211 - 233
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22675529 2012 Optimisation of over-expression in E. coli and biophysical characterisation of human membrane protein synaptogyrin 1.
19665806 2009 No association between bipolar disorder and syngr1 or synapsin II polymorphisms in the Han Chinese population.
19641478 2009 Association study and mutational screening of SYNGR1 as a candidate susceptibility gene for schizophrenia.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17049558 2007 Identification of rare mutations of synaptogyrin 1 gene in patients with schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16215643 2005 SYNGR1 is associated with schizophrenia and bipolar disorder in southern India.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14732601 2004 A nonsense mutation in the synaptogyrin 1 gene in a family with schizophrenia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11086983 2000 Molecular characterization of schizophrenia viewed by microarray analysis of gene expression in prefrontal cortex.
10595519 1999 Essential roles in synaptic plasticity for synaptogyrin I and synaptophysin I.
10591208 1999 The DNA sequence of human chromosome 22.
9760194 1998 Characterization of the human synaptogyrin gene family.