Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.86
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
DEAFNESS, AUTOSOMAL RECESSIVE 76 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 4.0
Disease Target Count Z-score Confidence
Sensorineural hearing loss 106 4.154 2.1

Expression

  Differential Expression (8)

Disease log2 FC p
breast carcinoma 1.200 2.1e-02
ductal carcinoma in situ 1.400 1.2e-02
fibroadenoma 1.800 3.0e-02
invasive ductal carcinoma 1.800 1.3e-02
osteosarcoma -2.359 8.1e-08
ovarian cancer 2.300 1.0e-10
psoriasis -1.300 3.7e-20
subependymal giant cell astrocytoma -1.222 4.1e-02

Gene RIF (1)

AA Sequence

MALSLPLGPRLGSEPLNHPPGAPREADIVGCTVCPASGEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEP      1 - 70
AAHPPRWSTPSSYEDPAGGKHCEHPISGLEVLEAEQNSLHLCLLGLGRRLQDLEQGLGHWALAQSGMVQL     71 - 140
QALQVDLRGAAERVEALLAFGEGLAQRSEPRAWAALEQILRALGAYRDSIFRRLWQLQAQLVSYSLVFEE    141 - 210
ANTLDQDLEVEGDSDWPGPGGVWGPWAPSSLPTSTELEWDPAGDIGGLGPLGQKTARTLGVPCELCGQRG    211 - 280
PQGRGQGLEEADTSHSRQDMLESGLGHQKRLARHQRHSLLRKPQDKKRQASPHLQDVRLEGNPGAPDPAS    281 - 350
RQPLTFLLILFLLFLLLVGAMFLLPASGGPCCSHARIPRTPYLVLSYVNGLPPV                    351 - 404
//

Text Mined References (8)

PMID Year Title