Property Summary

NCBI Gene PubMed Count 48
PubMed Score 41.36
PubTator Score 34.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
hepatocellular carcinoma 1.100 8.8e-04
Waldenstrons macroglobulinemia 1.513 7.6e-03
Multiple myeloma 1.298 6.3e-03
psoriasis 3.200 1.7e-05
astrocytoma 1.900 4.8e-04
glioblastoma 1.700 7.3e-03
oligodendroglioma 1.100 1.8e-15
osteosarcoma 1.249 3.8e-04
group 3 medulloblastoma 1.800 9.9e-05
atypical teratoid / rhabdoid tumor 1.500 3.0e-09
medulloblastoma, large-cell 1.900 4.9e-05
primitive neuroectodermal tumor 1.400 1.6e-04
Amyotrophic Lateral Sclerosis 1.079 2.6e-06
acute quadriplegic myopathy 1.700 8.3e-08
tuberculosis and treatment for 6 months 1.100 9.8e-06
non-small cell lung cancer 1.214 1.6e-19
intraductal papillary-mucinous neoplasm ... -1.400 1.5e-02
lung cancer 1.100 3.7e-04
pediatric high grade glioma 1.200 4.9e-05
non primary Sjogren syndrome sicca 1.100 1.8e-02
lung adenocarcinoma 1.122 2.2e-05
Breast cancer 1.500 5.5e-12
invasive ductal carcinoma -1.100 3.3e-03
ovarian cancer 3.100 5.0e-07
Down syndrome 1.100 1.0e-02
dermatomyositis 1.500 1.4e-03

Gene RIF (16)

PMID Text
25100733 hnRNPQ6 is required for APOBEC1-enhanced IL8 production.
23980891 The inhibitory effect of hnRNP Q on YB-1 mRNA translation can be explained by its ability to pro-mote YB-1 binding to the regulatory element within the YB-1 mRNA 3' UTR.
23946508 The hnRNP Q is a novel substrate of SHP2 and the SHP2 activity may be also involved in RNA metabolisms via dephosphorylation of hnRNP Q.
23679954 These data indicate that hnRNP Q can stimulate the protein production of HIV-1 Rev-dependent mRNAs without changing mRNA levels and mRNA export, respectively.
23679954 hnRNP Q overexpression in HIV-1 infected HeLa cells increases levels of the HIV-1 Gag-p24 protein, while levels of viral Rev-dependent mRNAs are not affected
23125841 hnRNP Q overexpression in HIV-1 infected HeLa cells increases levels of the HIV-1 Gag-p24 protein, while levels of viral Rev-dependent mRNAs are not affected
22174317 hnRNP Q overexpression in HIV-1 infected HeLa cells increases levels of the HIV-1 Gag-p24 protein, while levels of viral Rev-dependent mRNAs are not affected
19808671 Data demonstrate that expression levels of hnRNP A1, Q, K, R, and U influence HIV-1 production by persistently infected
19808571 hnRNP Q overexpression in HIV-1 infected HeLa cells increases levels of the HIV-1 Gag-p24 protein, while levels of viral Rev-dependent mRNAs are not affected
19232660 SYNCRIP participates in both RNA replication and translation in HCV life cycle.
19137262 Results demonstrate that galectin-3 stabilizes hnRNP Q via complex formation, and reduction in the hnRNP Q level leads to slow proliferation and less susceptibility to 5-FU.
18794368 Data demonstrate that hnRNP Q is a splicing modulator of SMN2, further underscoring the potential of hnRNP Q as a therapeutic target for spinal muscular atrophy.
17010310 Results suggest hnRNPQ interacts via its acidic domain (AcD) with Apobec1 and that this interaction is regulated by AcD phosphorylation.
16765914 methylation of hnRNPQ is important for its nuclear localization
15475564 SYNCRIP is transported within the dendrite as a component of mRNA granules
15340051 The overexpression of NSAP1 specifically enhanced HCV IRES-dependent translation, and knockdown of NSAP1 by use of a small interfering RNA specifically inhibited the translation of HCV mRNA.

AA Sequence

MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNE      1 - 70
DGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPDEAKIKALLERTGYTLDVTTG     71 - 140
QRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTF    141 - 210
CTKEAAQEAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPD    211 - 280
DKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVT    281 - 350
EEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQR    351 - 420
QAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYED    421 - 490
FQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGN    491 - 560
VGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK           561 - 623
//

Text Mined References (57)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25100733 2014 The RNA-editing enzyme APOBEC1 requires heterogeneous nuclear ribonucleoprotein Q isoform 6 for efficient interaction with interleukin-8 mRNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23980891 2013 Identification of proteins specifically interacting with YB-1 mRNA 3' UTR and the effect of hnRNP Q on YB-1 mRNA translation.
23946508 2013 Heterogeneous nuclear ribonucleoprotein Q is a novel substrate of SH2 domain-containing phosphatase-2.
23679954 2013 Heterogenous nuclear ribonucleoprotein Q increases protein expression from HIV-1 Rev-dependent transcripts.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23071094 2012 Heterotrimeric GAIT complex drives transcript-selective translation inhibition in murine macrophages.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21715376 2011 Translation-competent 48S complex formation on HCV IRES requires the RNA-binding protein NSAP1.
21515746 2011 Modulation of exosome-mediated mRNA turnover by interaction of GTP-binding protein 1 (GTPBP1) with its target mRNAs.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19808671 2009 Identification of a heterogeneous nuclear ribonucleoprotein-recognition region in the HIV Rev protein.
19647514 2009 Two-site phosphorylation of EPRS coordinates multimodal regulation of noncanonical translational control activity.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19535251 2009 The GAIT system: a gatekeeper of inflammatory gene expression.
19523114 2009 Functional association of human Ki-1/57 with pre-mRNA splicing events.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19232660 2009 SYNCRIP (synaptotagmin-binding, cytoplasmic RNA-interacting protein) is a host factor involved in hepatitis C virus RNA replication.
19137262 2009 Galectin-3 stabilizes heterogeneous nuclear ribonucleoprotein Q to maintain proliferation of human colon cancer cells.
19060904 2009 An empirical framework for binary interactome mapping.
19029303 2009 Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs.
18794368 2008 The RNA binding protein hnRNP Q modulates the utilization of exon 7 in the survival motor neuron 2 (SMN2) gene.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
17010310 2006 The acidic domain of hnRNPQ (NSAP1) has structural similarity to Barstar and binds to Apobec1.
16765914 2006 The methylation of the C-terminal region of hnRNPQ (NSAP1) is important for its nuclear localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479637 2004 Noncanonical function of glutamyl-prolyl-tRNA synthetase: gene-specific silencing of translation.
15475564 2004 An RNA-interacting protein, SYNCRIP (heterogeneous nuclear ribonuclear protein Q1/NSAP1) is a component of mRNA granule transported with inositol 1,4,5-trisphosphate receptor type 1 mRNA in neuronal dendrites.
15340051 2004 A cellular RNA-binding protein enhances internal ribosomal entry site-dependent translation through an interaction downstream of the hepatitis C virus polyprotein initiation codon.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12674497 2003 Identification and characterization of proteins that selectively interact with isoforms of the mRNA binding protein AUF1 (hnRNP D).
12601080 2003 Signaling initiated by overexpression of the fibroblast growth factor receptor-1 investigated by mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12376575 2002 Hyperphosphorylated C-terminal repeat domain-associating proteins in the nuclear proteome link transcription to DNA/chromatin modification and RNA processing.
11994298 2002 Identification of pp68 as the Tyrosine-phosphorylated Form of SYNCRIP/NSAP1. A cytoplasmic RNA-binding protein.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11773003 2002 Specific interaction of Smn, the spinal muscular atrophy determining gene product, with hnRNP-R and gry-rbp/hnRNP-Q: a role for Smn in RNA processing in motor axons?
11574476 2001 SMN interacts with a novel family of hnRNP and spliceosomal proteins.
11352648 2001 Two-hybrid cloning identifies an RNA-binding protein, GRY-RBP, as a component of apobec-1 editosome.
11134005 2001 Identification of GRY-RBP as an apolipoprotein B RNA-binding protein that interacts with both apobec-1 and apobec-1 complementation factor to modulate C to U editing.
11051545 2000 A mechanism for translationally coupled mRNA turnover: interaction between the poly(A) tail and a c-fos RNA coding determinant via a protein complex.
10734137 2000 SYNCRIP, a cytoplasmic counterpart of heterogeneous nuclear ribonucleoprotein R, interacts with ubiquitous synaptotagmin isoforms.
9847309 1999 A novel heterogeneous nuclear ribonucleoprotein-like protein interacts with NS1 of the minute virus of mice.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.