Property Summary

NCBI Gene PubMed Count 40
PubMed Score 0.00
PubTator Score 89.03

Knowledge Summary

Patent

No data available

Gene RIF (17)

PMID Text
25088614 Both GABRA6 and Synapsin II polymorphisms are important risk factors for the development of idiopathic generalized epilepsy in a South Indian population.
23956174 Results identify SYN2 as a novel predisposing gene for autism spectrum disorders (ASD) and strengthen the hypothesis that a disturbance of synaptic homeostasis underlies ASD.
22384280 Synapsin II is involved in the molecular pathway of lithium treatment in bipolar disorder
21465568 SYN2 rs3773364 A>G polymorphism is not a risk factor for susceptibility to epilepsy in this case-control study and meta-analysis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20034013 Results from our study indicate the involvement of SYN2 gene polymorphism in conferring risk to epilepsy; however, the genetic variant does not seem to modulate drug-response in epilepsy pharmacotherapy.
20034013 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19665806 A case-control study with synapsin II was conducted in 506 bipolar disorder patients and 507 healthy individuals from the Han Chinese population. No association was found in this study.
19665806 Observational study of gene-disease association. (HuGE Navigator)
17913586 Meta-analysis of gene-disease association. (HuGE Navigator)
17766091 Syn2 is likely to be involved in the etiology or pathogenesis of schizophrenia.
16131404 Observational study of gene-disease association. (HuGE Navigator)
15449241 synapsin II variants are associated with susceptibility to schizophrenia.
15271586 Observational study of gene-disease association. (HuGE Navigator)
15271586 This study suggests a positive association between synapsin II and schizophrenia, implying that synapsin II is involved in the etiology of schizophrenia.

AA Sequence

MMNFLRRRLSDSSFIANLPNGYMTDLQRPEPQQAPTPPPPGPGAASASAAPPTASPGPERTPPAASAPAP      1 - 70
PPARTPSVGSSLFSSLSQAVKQTAASAGLVDAPGAAPAAARKAKVLLVVDEPHADWAKCFRGKKVLGDYD     71 - 140
IKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLIIGMQYAGL    141 - 210
PSINSLESIYNFCDKPWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEMLTLPTFPVVVKIGHAHSGMGKV    211 - 280
KVENHYDFQDIASVVALTQTYATAEPFIDSKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMS    281 - 350
DRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQLLSR    351 - 420
TPALSPQRPLTTQQPQSGTLKDPDSSKTPPQRPPPQGGPGQPQGMQPPGKVLPPRRLPPGPSLPPSSSSS    421 - 490
SSSSSSAPQRPGGPTTHGDAPSSSSSLAEAQPPLAAPPQKPQPHPQLNKSQSLTNAFSFSESSFFRSSAN    491 - 560
EDEAKAETIRSLRKSFASLFSD                                                    561 - 582
//

Text Mined References (41)

PMID Year Title
25088614 2014 Association of GABRA6 1519 T>C (rs3219151) and Synapsin II (rs37733634) gene polymorphisms with the development of idiopathic generalized epilepsy.
23956174 2014 SYN2 is an autism predisposing gene: loss-of-function mutations alter synaptic vesicle cycling and axon outgrowth.
23896626 2013 Identification of novel DNA-methylated genes that correlate with human prostate cancer and high-grade prostatic intraepithelial neoplasia.
23806299 2013 New methods for inducing the differentiation of amniotic-derived mesenchymal stem cells into motor neuron precursor cells.
23492904 2013 A novel human endogenous retroviral protein inhibits cell-cell fusion.
23443540 2013 Synapsin II desynchronizes neurotransmitter release at inhibitory synapses by interacting with presynaptic calcium channels.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22571925 2013 H3K4 tri-methylation in synapsin genes leads to different expression patterns in bipolar disorder and major depression.
22384280 2012 Synapsin II is involved in the molecular pathway of lithium treatment in bipolar disorder.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21465568 2011 Lack of association between synapsin II (SYN2) gene polymorphism and susceptibility epilepsy: a case-control study and meta-analysis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20034013 2010 Association of intronic polymorphism rs3773364 A>G in synapsin-2 gene with idiopathic epilepsy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19665806 2009 No association between bipolar disorder and syngr1 or synapsin II polymorphisms in the Han Chinese population.
18372903 2008 Meta-analysis of genome-wide association data and large-scale replication identifies additional susceptibility loci for type 2 diabetes.
17913586 2007 Multicentre search for genetic susceptibility loci in sporadic epilepsy syndrome and seizure types: a case-control study.
17766091 2007 Association of synapsin 2 with schizophrenia in families of Northern European ancestry.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16131404 2005 Association study of polymorphisms in synaptic vesicle-associated genes, SYN2 and CPLX2, with schizophrenia.
15449241 2004 Family-based association study of synapsin II and schizophrenia.
15271586 2004 Positive association between synapsin II and schizophrenia.
15217342 2004 The synaptic vesicle cycle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11867766 2002 Neuronal nitric-oxide synthase localization mediated by a ternary complex with synapsin and CAPON.
11571277 2001 PrPC directly interacts with proteins involved in signaling pathways.
10578110 1999 Molecular evolution of the synapsin gene family.
10571231 1999 A phospho-switch controls the dynamic association of synapsins with synaptic vesicles.
10565545 1999 Cloning of cDNAs encoding human synapsins IIa and IIb.
10358015 1999 Homo- and heterodimerization of synapsins.
9463375 1998 In mouse brain profilin I and profilin II associate with regulators of the endocytic pathway and actin assembly.
9430678 1998 Synapsins I and II are ATP-binding proteins with differential Ca2+ regulation.
8964517 1996 Cloning and sequencing analysis of a human synapsin IIb-encoding brain cDNA.
8530057 1995 Localization of the synapsin II (SYN2) gene to human chromosome 3 and mouse chromosome 6.
8430330 1993 Synaptic vesicle phosphoproteins and regulation of synaptic function.
7592648 1995 The human synapsin II gene promoter. Possible role for the transcription factor zif268/egr-1, polyoma enhancer activator 3, and AP2.
2506642 1989 Synapsins: mosaics of shared and individual domains in a family of synaptic vesicle phosphoproteins.