Property Summary

NCBI Gene PubMed Count 418
PubMed Score 1437.44
PubTator Score 863.61

Knowledge Summary

Patent (140,169)

TINX Plot

  Disease (5)

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.400 8.7e-03
Astrocytoma, Pilocytic 1.200 6.6e-06
diabetes mellitus -1.200 1.9e-02
glioblastoma 1.100 6.6e-03
intraductal papillary-mucinous adenoma (... 1.100 1.3e-02
intraductal papillary-mucinous carcinoma... 1.600 2.0e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.8e-02
invasive ductal carcinoma 1.060 7.9e-04
lung cancer 1.500 1.3e-02
lung carcinoma -1.900 6.3e-28
medulloblastoma, large-cell 1.400 1.4e-02
Multiple myeloma -1.027 3.3e-02
osteosarcoma -3.212 8.4e-06
ovarian cancer 1.200 2.0e-03
primary Sjogren syndrome 1.500 2.8e-03
psoriasis 1.100 5.4e-08
subependymal giant cell astrocytoma 2.099 1.3e-02
tuberculosis 1.200 1.4e-05
urothelial carcinoma -1.300 7.2e-04
Waldenstrons macroglobulinemia 1.921 1.0e-03

Gene RIF (255)

AA Sequence

MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIEREL      1 - 70
NGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQG     71 - 140
QALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHE    141 - 210
GKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSH    211 - 280
PATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYES    281 - 350
PYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE    351 - 420
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNF    421 - 490
VHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGV    491 - 560
LMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYY    561 - 630
YDVVN                                                                     631 - 635
//

Text Mined References (426)

PMID Year Title