Property Summary

NCBI Gene PubMed Count 7
PubMed Score 42.54
PubTator Score 0.60

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 2.2e-07
ovarian cancer 8520 1.2e-06
osteosarcoma 7950 1.8e-05
adult high grade glioma 3801 2.1e-05
glioblastoma 5792 4.0e-05
psoriasis 6694 6.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hypertrichosis 46 3.211 1.6


  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.200 2.1e-05
atypical teratoid / rhabdoid tumor 1.400 2.2e-07
glioblastoma 1.300 4.0e-05
osteosarcoma 2.210 1.8e-05
ovarian cancer -1.100 1.2e-06
psoriasis 1.500 6.3e-04

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (1)

AA Sequence

DDFDAPFNPHLNLKDFDALILDLERELSKQINVCL                                       701 - 735

Text Mined References (12)

PMID Year Title