Property Summary

NCBI Gene PubMed Count 27
PubMed Score 144.91
PubTator Score 97.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.480 1.5e-10

Gene RIF (19)

PMID Text
25059562 The T657C polymorphism of the SYCP3 gene is possibly associated with recurrent pregnancy loss of unknown cause in human.
24950965 SYCP3 binding and assembly on meiotic chromosomes leads to their organisation into compact structures compatible with recombination and crossover formation
24905095 SCP3 plays an important role in the progression of cervical cancer
23100464 screening for genetic variants in AURKB and SYCP3 among these patients with reproductive problems using Sanger sequencing. Only one apparently non-pathogenic deletion was found in SYCP3.
23069255 Positive synaptonemal complex protein 3 expression is a portent of poor outcome and may be a potential biomarker in the early stages of the non-small cell lung cancer for survival.
22670862 SYCP3 mutations are not associated with the genetic susceptibility for meiotic arrest in infertile male patients with nonobstructive azoospermia in the Turkish population
22197129 mutations in SYCP3 do not contribute significantly to risk for recurrent miscarriage through maternal meiotic nondisjunction.
22116401 Expression of SYCP3 inhibits the homologous recombination (HR) pathway mediated by RAD51.
21357605 The 657T>C mutation of SYCP3 may not be associated with recurrent miscarriage caused by aneuploidy.
21126912 mutation analysis of SYCP3, DNMT3L and MSH4 in patients with maturation arrest of spermatogenesis and couples with recurrent miscarriages; heterozygous change, detected in a conserved functional domain of the SYCP3 gene, was absent in >200 controls
20395201 X-linked lymphocyte-regulated protein pM1 (XMR), XLR, and SCP3 render tumor cells resistant to antitumor immunity
19110213 mutations in SYPR3 are likely to generate an aberrant synaptonemal complex in a dominant-negative manner and contribute to abnormal chromosomal behavior that might lead to recurrent miscarriage.
19110213 Observational study of gene-disease association. (HuGE Navigator)
18256545 These observations suggest that SCP3 is expressed in adult human and monkey ovaries.
17434513 No functional SYCP3 exonic SNP was found in infertile Spanish patients with meiosis arrest, suggesting that SYCP3 mutations very likely are not relevant in Spain in genetic susceptibility to meiosis arrest.
16824523 SYCP3 is expressed in human testis and is restricted to germ cells. Lack of SYCP3 expression in human testis may have a negative effect on spermatogenesis and male fertility.
16213863 In contrast to previously reported high frequency of SYCP3 mutations in patients with azoospermia, only polymorphisms are found in the present study
14643120 Observational study of gene-disease association. (HuGE Navigator)
14643120 We suggest that SYCP3 has an essential meiotic function in human spermatogenesis that is compromised by the mutant protein via dominant negative interference.

AA Sequence

MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEV      1 - 70
QNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDM     71 - 140
QKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAM    141 - 210
LQKKIMMETQQQEIASVRKSLQSMLF                                                211 - 236
//

Text Mined References (27)

PMID Year Title
25059562 2014 The T657C polymorphism on the SYCP3 gene is associated with recurrent pregnancy loss.
24950965 2014 A molecular model for the role of SYCP3 in meiotic chromosome organisation.
24905095 2014 Synaptonemal complex protein 3 is a prognostic marker in cervical cancer.
23100464 2013 Mutation screening of AURKB and SYCP3 in patients with reproductive problems.
23069255 2013 Synaptonemal complex protein 3 as a novel prognostic marker in early stage non-small cell lung cancer.
22899867 2012 Analysis of meiosis regulators in human gonads: a sexually dimorphic spatio-temporal expression pattern suggests involvement of DMRT1 in meiotic entry.
22670862 2013 Investigation of mutations in the synaptonemal complex protein 3 (SYCP3) gene among azoospermic infertile male patients in the Turkish population.
22197129 2012 Absence of SYCP3 mutations in women with recurrent miscarriage with at least one trisomic miscarriage.
22116401 2011 Synaptonemal complex protein SYCP3 impairs mitotic recombination by interfering with BRCA2.
21357605 2011 SYCP3 mutation may not be associated with recurrent miscarriage caused by aneuploidy.
21126912 2011 Mutation analysis of three genes in patients with maturation arrest of spermatogenesis and couples with recurrent miscarriages.
20395201 2010 Ectopic expression of X-linked lymphocyte-regulated protein pM1 renders tumor cells resistant to antitumor immunity.
20339291 2010 Synaptonemal complex protein SYCP3 exists in two isoforms showing different conservation in mammalian evolution.
19110213 2009 Mutations of the SYCP3 gene in women with recurrent pregnancy loss.
18256545 2008 Mammalian neo-oogenesis and expression of meiosis-specific protein SCP3 in adult human and monkey ovaries.
17434513 2007 Mutations of SYCP3 are rare in infertile Spanish men with meiotic arrest.
16824523 2006 Testicular expression of synaptonemal complex protein 3 (SYCP3) messenger ribonucleic acid in 110 patients with nonobstructive azoospermia.
16213863 2005 SYCP3 mutations are uncommon in patients with azoospermia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15218256 2004 Kinetics of meiosis in azoospermic males: a joint histological and cytological approach.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14643120 2003 Azoospermia in patients heterozygous for a mutation in SYCP3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213195 2002 A new gene family (FAM9) of low-copy repeats in Xp22.3 expressed exclusively in testis: implications for recombinations in this region.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10854409 2000 Comparative genome sequence analysis of the Bpa/Str region in mouse and Man.
9774970 1998 Stable interaction between the products of the BRCA1 and BRCA2 tumor suppressor genes in mitotic and meiotic cells.