Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.70
PubTator Score 1.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 3.2e-05
group 4 medulloblastoma 1855 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.400 2.0e-02
medulloblastoma, large-cell 2.300 3.2e-05

Gene RIF (2)

AA Sequence

MQAKNKDALQPIKEDRTGKAQDDAFWLQSLITDAFHDKGFQKIKEYFQQKESHFPQKYNRLLLYRLDRSI      1 - 70
NKELDKNEFQSVSLLLKCIQRFLVDGLKEDEPLLIRQGLIPKLVSWFERTTGILTSEGLASDTSLICVIE     71 - 140
DFFDTALIISRSSSEGKIQMLDSFLLSLGFLVTEKTVNHLLQQEGLKTFNCILHAVPREERKKFPLSEGM    141 - 210
CHLMKDLARTLLTVGDYDQQVAISEALCRLTIKKSRDELVHKWFDDEVIAEAFKEIKDREFETDSRRFLN    211 - 280
HLNNRLGDQRRVYSFPCIAAFADEHEMRKPADEKLEKFWIDFNLGSQSVTFYIDNAENTLWDSVTLPKEA    281 - 350
VMNFSITETEKIKIFIIYLKKPMIISYKEVMKIEIHFDLQFNISQVSIQALGEDKQMLPDQTKISSELFS    351 - 420
KSDKEDRESPSGLERETEQAEESTNMVEFMSAEDDRCLITLHLNDQSEPPVIGEPASDSHLQPVPPFGVP    421 - 490
DFPQQPKSHYRKHLFSESNQDSSTSELSWTSNQKKKSLKSYSSRKKTRTRSNLRILPVFPPSSGSGHEKD    491 - 560
QAKLLSPSEKEIPEQNNTTSPKTSEQKFQDSFAFLTAEDSAQKTELQDPHSLSELSSLKHSEDEEKPKIV    561 - 630
NQESLTESTSLKHKLRNLEDKDIPEGSFAKSQQSRLEEEVAPGSPFSITEERELPEGISTSSLEVVPENL    631 - 700
NGSAILPTFENFTKKRKRKYELRYRKRPFNSENAKKAPDCLIKLLNQMQLFRLNKLERFQNLVLQELSSL    701 - 770
KQDIQALEHLEKEVLEFWGKQSADLQSFCDLQVLRFNSTQTS                                771 - 812
//

Text Mined References (14)

PMID Year Title