Property Summary

NCBI Gene PubMed Count 3
PubMed Score 134.40
PubTator Score 8.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MSPLRPLLLALALASVPCAQGACPASADLKHSDGTRTCAKLYDKSDPYYENCCGGAELSLESGADLPYLP      1 - 70
SNWANTASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCS           71 - 134
//

Text Mined References (4)

PMID Year Title