Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.92
PubTator Score 3.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.2e-10
osteosarcoma 7950 1.8e-06
group 4 medulloblastoma 1855 1.3e-04
oligodendroglioma 2850 3.3e-02
Disease Target Count Z-score Confidence
Peripheral vascular disease 87 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 1.200 1.3e-04
oligodendroglioma 1.300 3.3e-02
osteosarcoma -2.280 1.8e-06
ovarian cancer 1.100 1.2e-10

Gene RIF (3)

AA Sequence

MERQGVDVPHVKCKDQEPQPLGESKEHPRWEENCEEEAGGGPASASCQLTVLEGKSGLYFSSLDSSIDIL      1 - 70
QKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYNDHNKIIQEKLQEFTQKMAKIS     71 - 140
HLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFVSSVAETTSQATASEV    141 - 210
QTNRDGEC                                                                  211 - 218
//

Text Mined References (12)

PMID Year Title