Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.08
PubTator Score 2.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 4.6e-07

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.200 4.6e-07

AA Sequence

MAGKLKPLNVEAPEATEEAEGQAKSLKTEDLLAMVIKLQKEGSLEPQIEDLISRINDLQQAKKKSSEELR      1 - 70
ETHSLWEALHRELDSLNGEKVHLEEVLGKKQEALRILQMHCQEKESEAQRLDVRGQLEDLMGQHKDLWEF     71 - 140
HMLEQRLAREIRALERSKEQLLSERRLVRAKLREVERRLHSPPEVEGAMAVNDGLKAELEIFGEQVRSAP    141 - 210
EVGAGEGEAGPELPRARDEEDPEPPVAAPDAL                                          211 - 242
//

Text Mined References (3)

PMID Year Title