Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 2.2e-04

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.251 2.2e-04

Synonym

Accession Q6NVH7 Q8NAM1
Symbols SWS1AP1
C19orf39
ZSWIM7AP1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
21965664 the human Shu complex (hSWS1.SWSAP1) has an evolutionarily conserved function in homologous recombination

AA Sequence

MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPP      1 - 70
STRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVA     71 - 140
LQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPW    141 - 210
PTQAGDPSSGKGSSSGGQP                                                       211 - 229
//

Text Mined References (5)

PMID Year Title
21965664 2011 hSWS1·SWSAP1 is an evolutionarily conserved complex required for efficient homologous recombination repair.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.