Property Summary

NCBI Gene PubMed Count 6
PubMed Score 19.85
PubTator Score 9.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.4e-04
osteosarcoma 7933 1.4e-02
Disease Target Count Z-score Confidence
Acute monocytic leukemia 11 3.318 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.322 1.4e-02
ovarian cancer 1.200 1.4e-04

Synonym

Accession Q1ZZU3 Q5SYX7 Q5SYX8 Q8N2W6
Symbols SAE3
C9orf119

Gene

  Ortholog (1)

Species Source Disease
Chimp EggNOG Inparanoid

 GO Component (2)

Gene RIF (2)

PMID Text
27265469 HBV DNAPTP1 downregulated the expression of SWI5 and CTC1 at translation level.
21252223 that human SWI5-MEI5 has an evolutionarily conserved function in homologous recombination repair.

AA Sequence

MQRRGQRDLWRHNKSCARNRCPRPPRERGGAGFPWVRAQLSVRQFTLRVRVPGPVHLRGRSPTPALDPLA      1 - 70
PLNPLIRGPRTPGLRRWIQSLALLLPNCSSSRIPTVPRPHSGLWVQSDFPLGFLSRTEPRLTRSCRGAFR     71 - 140
SPRPLPKSGQADGTSEESLHLDIQKLKEKRDMLDKEISQFVSEGYSVDELEDHITQLHEYNDIKDVGQML    141 - 210
MGKLAVIRGVTTKELYPEFGLDMND                                                 211 - 235
//

Text Mined References (8)

PMID Year Title
27265469 2016 Downregulation of SWI5 and CTC1 genes: hepatitis B virus DNA polymerase transactivated protein 1-mediated inhibition of DNA repair.
23754376 2013 FIGNL1-containing protein complex is required for efficient homologous recombination repair.
21252223 2011 The role of the human SWI5-MEI5 complex in homologous recombination repair.
20976249 2010 Role for the mammalian Swi5-Sfr1 complex in DNA strand break repair through homologous recombination.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.