Property Summary

NCBI Gene PubMed Count 6
PubMed Score 21.10
PubTator Score 9.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.322 1.4e-02
ovarian cancer 1.200 1.4e-04

 GO Component (2)

Gene RIF (2)

AA Sequence

MQRRGQRDLWRHNKSCARNRCPRPPRERGGAGFPWVRAQLSVRQFTLRVRVPGPVHLRGRSPTPALDPLA      1 - 70
PLNPLIRGPRTPGLRRWIQSLALLLPNCSSSRIPTVPRPHSGLWVQSDFPLGFLSRTEPRLTRSCRGAFR     71 - 140
SPRPLPKSGQADGTSEESLHLDIQKLKEKRDMLDKEISQFVSEGYSVDELEDHITQLHEYNDIKDVGQML    141 - 210
MGKLAVIRGVTTKELYPEFGLDMND                                                 211 - 235
//

Text Mined References (8)

PMID Year Title