| Tbio | Switch-associated protein 70 |
Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. It also mediates signaling of membrane ruffling. Regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion (By similarity).
Comments
| Disease | Target Count | P-value |
|---|---|---|
| lung carcinoma | 2844 | 3.0e-18 |
| ovarian cancer | 8491 | 2.2e-08 |
| Duchenne muscular dystrophy | 602 | 5.3e-08 |
| Breast cancer | 3098 | 1.2e-07 |
| ependymoma | 2514 | 1.2e-06 |
| ulcerative colitis | 2087 | 3.0e-05 |
| pilocytic astrocytoma | 3086 | 3.2e-05 |
| Pick disease | 1893 | 7.1e-05 |
| tuberculosis | 1563 | 9.3e-05 |
| primary Sjogren syndrome | 788 | 4.1e-04 |
| lung cancer | 4473 | 5.6e-04 |
| Down syndrome | 548 | 1.4e-03 |
| autosomal dominant Emery-Dreifuss muscular dystrophy | 499 | 1.5e-03 |
| invasive ductal carcinoma | 2950 | 2.4e-03 |
| Waldenstrons macroglobulinemia | 764 | 2.7e-03 |
| gastric carcinoma | 832 | 4.1e-03 |
| glioblastoma | 5572 | 4.2e-03 |
| dermatomyositis | 966 | 1.0e-02 |
| aldosterone-producing adenoma | 664 | 1.8e-02 |
| medulloblastoma, large-cell | 6234 | 2.7e-02 |
| spina bifida | 1064 | 4.0e-02 |
| intraductal papillary-mucinous adenoma (IPMA) | 2956 | 4.3e-02 |
| astrocytic glioma | 2241 | 4.5e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| X-linked hyper IgM syndrome | 5 | 3.028 | 1.5 |
| Disease | log2 FC | p |
|---|---|---|
| Waldenstrons macroglobulinemia | 1.293 | 2.7e-03 |
| astrocytic glioma | -1.300 | 4.5e-02 |
| ependymoma | 1.300 | 1.2e-06 |
| glioblastoma | 1.100 | 4.2e-03 |
| medulloblastoma, large-cell | -1.100 | 2.7e-02 |
| Duchenne muscular dystrophy | 1.042 | 5.3e-08 |
| autosomal dominant Emery-Dreifuss muscul... | 1.144 | 1.5e-03 |
| tuberculosis | -1.200 | 9.3e-05 |
| intraductal papillary-mucinous adenoma (... | -1.200 | 4.3e-02 |
| lung cancer | -2.100 | 5.6e-04 |
| pilocytic astrocytoma | 1.500 | 3.2e-05 |
| primary Sjogren syndrome | 1.500 | 4.1e-04 |
| aldosterone-producing adenoma | -1.178 | 1.8e-02 |
| lung carcinoma | -1.300 | 3.0e-18 |
| spina bifida | -1.156 | 4.0e-02 |
| Pick disease | 1.200 | 7.1e-05 |
| Breast cancer | -1.200 | 1.2e-07 |
| gastric carcinoma | 1.700 | 4.1e-03 |
| invasive ductal carcinoma | -1.400 | 2.4e-03 |
| ulcerative colitis | 1.900 | 3.0e-05 |
| ovarian cancer | -2.500 | 2.2e-08 |
| Down syndrome | 1.300 | 1.4e-03 |
| dermatomyositis | 1.100 | 1.0e-02 |
| PMID | Text | |
|---|---|---|
| 25889342 | SWAP70 appears to act as a molecular intermediate between vGPCR and endothelial activation. | |
| 22944692 | Positional proteomics analysis identifies the cleavage of human SWAP switching B-cell complex 70kDa subunit (SWAP70) at amino acid residues 566-567 by the HIV-1 protease | |
| 22728961 | Detection of SWAP70 antibodies during the attack period might suggest that SWAP70 is involved in Multiple Sclerosis relapse pathogenesis | |
| 22247562 | The unwinding of the C-terminal alpha-helix could regulate the functions of SWAP-70 at the plasma membrane surface. | |
| 22210919 | findings suggest that regulation of eosinophil trafficking and migration by SWAP-70 is important for the development of eosinophilic inflammation after allergen exposure | |
| 21360565 | SWAP70 may be a target of miR-145, and it might have a potential oncogenic function. | |
| 20800603 | Observational study of gene-disease association. (HuGE Navigator) | |
| 17371938 | SWAP-70 may be involved in regulating migration and invasion of trophoblast cells during the processes of embryonic implantation and placentation in primates. | |
| 16547421 | surface expression of SWAP-70 on HIV-1 infected cells as well as PBMCs; SWAP-70 may serve as a marker for T cell differentiation as well as for HIV-1 infection | |
| 16418221 | the binding activity of SWAP-70 to non-muscle F-actin is required for membrane ruffling. | |
| 12925760 | Overexpression of SWAP-70 altered the actin organization and lamellipodial morphology | |
| 11726218 | protein that functions as the only B cell-specific component of an isotype switch recombination |
MGSLKEELLKAIWHAFTALDQDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDDEGPVSNQGYM 1 - 70 PYLNRFILEKVQDNFDKIEFNRMCWTLCVKKNLTKNPLLITEEDAFKIWVIFNFLSEDKYPLIIVSEEIE 71 - 140 YLLKKLTEAMGGGWQQEQFEHYKINFDDSKNGLSAWELIELIGNGQFSKGMDRQTVSMAINEVFNELILD 141 - 210 VLKQGYMMKKGHRRKNWTERWFVLKPNIISYYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCF 211 - 280 DKTFEISASDKKKKQEWIQAIHSTIHLLKLGSPPPHKEARQRRKELRKKQLAEQEELERQMKELQAANES 281 - 350 KQQELEAVRKKLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVR 351 - 420 ELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEAEKQELENQRV 421 - 490 LKEQALQEAMEQLEQLELERKQALEQYEEVKKKLEMATNKTKSWKDKVAHHEGLIRLIEPGSKNPHLITN 491 - 560 WGPAAFTEAELEEREKNWKEKKTTE 561 - 585 //
| PMID | Year | Title | |
|---|---|---|---|
| 25889342 | 2015 | The guanine exchange factor SWAP70 mediates vGPCR-induced endothelial plasticity. | |
| 25468996 | 2014 | E-cadherin interactome complexity and robustness resolved by quantitative proteomics. | |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 22728961 | 2012 | Switch-associated protein 70 antibodies in multiple sclerosis: relationship between increased serum levels and clinical relapse. | |
| 22247562 | 2012 | Membrane-induced alteration of the secondary structure in the SWAP-70 pleckstrin homology domain. | |
| 22210919 | 2012 | Regulation of eosinophil trafficking by SWAP-70 and its role in allergic airway inflammation. | |
| 21360565 | 2011 | SWAP70, actin-binding protein, function as an oncogene targeting tumor-suppressive miR-145 in prostate cancer. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 20800603 | 2010 | Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study. | |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 17371938 | 2007 | Expression and localization of SWAP-70 in human fetomaternal interface and placenta during tubal pregnancy and normal placentation. | |
| 16547421 | 2006 | Diagnostic surface expression of SWAP-70 on HIV-1 infected T cells. | |
| 16418221 | 2006 | Direct binding of SWAP-70 to non-muscle actin is required for membrane ruffling. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12925760 | 2003 | SWAP-70 identifies a transitional subset of actin filaments in motile cells. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11726218 | 2001 | Analysis of SWAP-70 as a candidate gene for non-X-linked hyper IgM syndrome and common variable immunodeficiency. | |
| 10681448 | 2000 | Association of SWAP-70 with the B cell antigen receptor complex. | |
| 9734811 | 1998 | Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. |
