Property Summary

NCBI Gene PubMed Count 19
PubMed Score 27.58
PubTator Score 28.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.293 2.7e-03
astrocytic glioma -1.300 4.5e-02
ependymoma 1.300 1.2e-06
glioblastoma 1.100 4.2e-03
medulloblastoma, large-cell -1.100 2.7e-02
Duchenne muscular dystrophy 1.042 5.3e-08
autosomal dominant Emery-Dreifuss muscul... 1.144 1.5e-03
tuberculosis -1.200 9.3e-05
intraductal papillary-mucinous adenoma (... -1.200 4.3e-02
lung cancer -2.100 5.6e-04
pilocytic astrocytoma 1.500 3.2e-05
primary Sjogren syndrome 1.500 4.1e-04
aldosterone-producing adenoma -1.178 1.8e-02
lung carcinoma -1.300 3.0e-18
spina bifida -1.156 4.0e-02
Pick disease 1.200 7.1e-05
Breast cancer -1.200 1.2e-07
gastric carcinoma 1.700 4.1e-03
invasive ductal carcinoma -1.400 2.4e-03
ulcerative colitis 1.900 3.0e-05
ovarian cancer -2.500 2.2e-08
Down syndrome 1.300 1.4e-03
dermatomyositis 1.100 1.0e-02

Gene RIF (12)

PMID Text
25889342 SWAP70 appears to act as a molecular intermediate between vGPCR and endothelial activation.
22944692 Positional proteomics analysis identifies the cleavage of human SWAP switching B-cell complex 70kDa subunit (SWAP70) at amino acid residues 566-567 by the HIV-1 protease
22728961 Detection of SWAP70 antibodies during the attack period might suggest that SWAP70 is involved in Multiple Sclerosis relapse pathogenesis
22247562 The unwinding of the C-terminal alpha-helix could regulate the functions of SWAP-70 at the plasma membrane surface.
22210919 findings suggest that regulation of eosinophil trafficking and migration by SWAP-70 is important for the development of eosinophilic inflammation after allergen exposure
21360565 SWAP70 may be a target of miR-145, and it might have a potential oncogenic function.
20800603 Observational study of gene-disease association. (HuGE Navigator)
17371938 SWAP-70 may be involved in regulating migration and invasion of trophoblast cells during the processes of embryonic implantation and placentation in primates.
16547421 surface expression of SWAP-70 on HIV-1 infected cells as well as PBMCs; SWAP-70 may serve as a marker for T cell differentiation as well as for HIV-1 infection
16418221 the binding activity of SWAP-70 to non-muscle F-actin is required for membrane ruffling.
12925760 Overexpression of SWAP-70 altered the actin organization and lamellipodial morphology
11726218 protein that functions as the only B cell-specific component of an isotype switch recombination

AA Sequence

MGSLKEELLKAIWHAFTALDQDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDDEGPVSNQGYM      1 - 70
PYLNRFILEKVQDNFDKIEFNRMCWTLCVKKNLTKNPLLITEEDAFKIWVIFNFLSEDKYPLIIVSEEIE     71 - 140
YLLKKLTEAMGGGWQQEQFEHYKINFDDSKNGLSAWELIELIGNGQFSKGMDRQTVSMAINEVFNELILD    141 - 210
VLKQGYMMKKGHRRKNWTERWFVLKPNIISYYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCF    211 - 280
DKTFEISASDKKKKQEWIQAIHSTIHLLKLGSPPPHKEARQRRKELRKKQLAEQEELERQMKELQAANES    281 - 350
KQQELEAVRKKLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVR    351 - 420
ELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEAEKQELENQRV    421 - 490
LKEQALQEAMEQLEQLELERKQALEQYEEVKKKLEMATNKTKSWKDKVAHHEGLIRLIEPGSKNPHLITN    491 - 560
WGPAAFTEAELEEREKNWKEKKTTE                                                 561 - 585
//

Text Mined References (21)

PMID Year Title
25889342 2015 The guanine exchange factor SWAP70 mediates vGPCR-induced endothelial plasticity.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
22728961 2012 Switch-associated protein 70 antibodies in multiple sclerosis: relationship between increased serum levels and clinical relapse.
22247562 2012 Membrane-induced alteration of the secondary structure in the SWAP-70 pleckstrin homology domain.
22210919 2012 Regulation of eosinophil trafficking by SWAP-70 and its role in allergic airway inflammation.
21360565 2011 SWAP70, actin-binding protein, function as an oncogene targeting tumor-suppressive miR-145 in prostate cancer.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17371938 2007 Expression and localization of SWAP-70 in human fetomaternal interface and placenta during tubal pregnancy and normal placentation.
16547421 2006 Diagnostic surface expression of SWAP-70 on HIV-1 infected T cells.
16418221 2006 Direct binding of SWAP-70 to non-muscle actin is required for membrane ruffling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12925760 2003 SWAP-70 identifies a transitional subset of actin filaments in motile cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11726218 2001 Analysis of SWAP-70 as a candidate gene for non-X-linked hyper IgM syndrome and common variable immunodeficiency.
10681448 2000 Association of SWAP-70 with the B cell antigen receptor complex.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.