Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.72
PubTator Score 0.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
active ulcerative colitis -1.607 5.7e-03
chronic rhinosinusitis -1.178 2.7e-02
ovarian cancer 1.500 2.0e-06
posterior fossa group B ependymoma 1.600 4.7e-04

AA Sequence

MATKPTEPVTILSLRKLSLGTAEPQVKEPKTFTVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAV      1 - 70
VSPVIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWF     71 - 140
VFLRTMVGCGVSGHSQGLIIKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASI    141 - 210
PGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRT    211 - 280
TLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIIS    281 - 350
TIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTA    351 - 420
EVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLMSASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ    421 - 490
IK                                                                        491 - 492
//

Text Mined References (4)

PMID Year Title