Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.35
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.500 3.6e-04
astrocytic glioma -1.600 2.0e-03
Astrocytoma, Pilocytic -1.700 1.1e-07
atypical teratoid / rhabdoid tumor -2.100 1.3e-10
ependymoma -1.800 1.6e-03
glioblastoma -1.700 6.7e-11
group 3 medulloblastoma -1.700 1.8e-02
lung carcinoma 2.700 1.0e-36
medulloblastoma, large-cell -1.300 1.6e-03
oligodendroglioma -1.400 2.5e-03
Pick disease -1.600 9.4e-03
pituitary cancer 1.200 4.9e-04
primitive neuroectodermal tumor -1.600 1.6e-04
subependymal giant cell astrocytoma -2.675 1.9e-02

AA Sequence

MEEDLFQLRQLPVVKFRRTGESARSEDDTASGEHEVQIEGVHVGLEAVELDDGAAVPKEFANPTDDTFMV      1 - 70
EDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLW     71 - 140
GNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCI    141 - 210
LLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKR    211 - 280
IATENGAPMPLGKLIISRQEDRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCGI    281 - 350
SSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFIC    351 - 420
VGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYLT    421 - 490
LAVYSGCCLLAALASCFLPIETKGRGLQESSHREWGQEMVGRGMHGAGVTRSNSGSQE                491 - 548
//

Text Mined References (7)

PMID Year Title