Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.07
PubTator Score 5.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma -2.900 1.8e-03
ependymoma -3.000 4.7e-03
oligodendroglioma -2.800 9.0e-03
glioblastoma -2.400 1.1e-03
osteosarcoma -2.675 6.3e-05
medulloblastoma -1.900 3.3e-04
atypical teratoid / rhabdoid tumor -2.100 1.3e-03
medulloblastoma, large-cell 1.200 1.9e-05
primitive neuroectodermal tumor -2.300 8.0e-03
Atopic dermatitis -1.500 1.4e-05
intraductal papillary-mucinous adenoma (... 1.900 1.8e-02
intraductal papillary-mucinous carcinoma... 1.200 4.0e-02
active Crohn's disease 1.024 9.0e-03
pediatric high grade glioma -2.200 7.0e-05
pilocytic astrocytoma -2.000 8.6e-05
non primary Sjogren syndrome sicca 1.500 2.6e-02
psoriasis -1.600 1.5e-33
subependymal giant cell astrocytoma -2.453 1.8e-02
lung carcinoma 2.200 3.1e-24
Pick disease -1.500 7.3e-03
ductal carcinoma in situ 1.600 2.4e-03
invasive ductal carcinoma 1.600 1.5e-02
ovarian cancer -1.200 2.9e-04

Gene RIF (4)

PMID Text
24100225 the interactions between P97 and these motifs, including VCP-binding motif (VBM) and VCP-interacting motif (VIM). The solution structures of the VBM motif from HRD1 and the VIM motif from SVIP are both comprised mainly of a single alpha-helix.
24055875 A major portion of SVIP is intrinsically disordered in solution.
21909394 SVIP plays a regulatory role in p97 subcellular localization and is a novel regulator of autophagy.
17872946 SVIP is an endogenous inhibitor of ERAD that acts through regulating the assembly of the gp78-p97/VCP-Derlin1 complex.

AA Sequence

MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEG      1 - 70
GLRWTVS                                                                    71 - 77
//

Text Mined References (17)

PMID Year Title
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24100225 2013 Structural and mechanistic insights into the arginine/lysine-rich peptide motifs that interact with P97/VCP.
24055875 2013 Structure and expression of a novel compact myelin protein - small VCP-interacting protein (SVIP).
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21909394 2011 SVIP induces localization of p97/VCP to the plasma and lysosomal membranes and regulates autophagy.
21896481 2011 The general definition of the p97/valosin-containing protein (VCP)-interacting motif (VIM) delineates a new family of p97 cofactors.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
18793143 2008 Regulation of ER-associated degradation via p97/VCP-interacting motif.
17872946 2007 Identification of SVIP as an endogenous inhibitor of endoplasmic reticulum-associated degradation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529442 2003 SVIP is a novel VCP/p97-interacting protein whose expression causes cell vacuolation.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.