Property Summary

NCBI Gene PubMed Count 22
PubMed Score 13.08
PubTator Score 10.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytoma -4.200 1.1e-03
posterior fossa group A ependymoma -5.700 1.0e-20
oligodendroglioma -3.500 7.0e-03
glioblastoma -4.600 1.8e-06
osteosarcoma -2.577 2.1e-05
medulloblastoma -3.300 1.7e-07
atypical teratoid / rhabdoid tumor -5.600 1.9e-14
medulloblastoma, large-cell -3.600 3.0e-06
primitive neuroectodermal tumor -4.600 1.6e-05
intraductal papillary-mucinous adenoma (... -3.300 2.8e-05
intraductal papillary-mucinous carcinoma... -3.400 3.6e-05
intraductal papillary-mucinous neoplasm ... -3.200 1.4e-03
pancreatic cancer -1.200 7.3e-03
breast carcinoma -1.400 1.3e-03
fibroadenoma -1.800 1.1e-02
pediatric high grade glioma -4.400 3.2e-08
pilocytic astrocytoma -5.700 3.3e-14
subependymal giant cell astrocytoma -4.140 2.0e-02
lung carcinoma 2.500 7.2e-12
Pick disease -2.100 3.1e-02
ductal carcinoma in situ -1.500 1.5e-03
invasive ductal carcinoma -1.500 9.5e-03
pituitary cancer 1.100 4.9e-02

 GO Process (1)

Gene RIF (7)

PMID Text
23617838 In classical mesial temporal sclerosis 1A, the expression of SV2 isoforms is altered with a marked decrease of SV2B paralleling synaptic loss.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18977120 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18524768 Synaptic vesicle protein 2 binds adenine nucleotides
18367154 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDDYKYQDNYGGYAPSDGYYRGNESNPEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVKAKQAKMAPSR      1 - 70
MDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGRFQWILFFVLGLALMADGVEVFVVSFALPSAEKDM     71 - 140
CLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRKRVLSMSLAVNASFASLSSFVQGYGAFLFCRLISGI    141 - 210
GIGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFV    211 - 280
IVCALPCTVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSNIKTPKQMDEFI    281 - 350
EIQSSTGTWYQRWLVRFKTIFKQVWDNALYCVMGPYRMNTLILAVVWFAMAFSYYGLTVWFPDMIRYFQD    351 - 420
EEYKSKMKVFFGEHVYGATINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFEDVTSTDTYFK    421 - 490
NCTIESTIFYNTDLYEHKFINCRFINSTFLEQKEGCHMDLEQDNDFLIYLVSFLGSLSVLPGNIISALLM    491 - 560
DRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGIL    561 - 630
NGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM                     631 - 683
//

Text Mined References (23)

PMID Year Title
27577871 2016 Synaptotagmin-2, and -1, linked to neurotransmission impairment and vulnerability in Spinal Muscular Atrophy.
25416956 2014 A proteome-scale map of the human interactome network.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
23617838 2014 Expression pattern of synaptic vesicle protein 2 (SV2) isoforms in patients with temporal lobe epilepsy and hippocampal sclerosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19043545 2008 Genetics meets metabolomics: a genome-wide association study of metabolite profiles in human serum.
18977120 2009 No major role of common SV2A variation for predisposition or levetiracetam response in epilepsy.
18524768 2008 Synaptic vesicle protein 2 binds adenine nucleotides.
18367154 2008 Linkage disequilibrium mapping of a chromosome 15q25-26 major depression linkage region and sequencing of NTRK3.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466855 2004 SV2B regulates synaptotagmin 1 by direct interaction.
15217342 2004 The synaptic vesicle cycle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10624962 1999 SV2A and SV2B function as redundant Ca2+ regulators in neurotransmitter release.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7681585 1993 Brain contains two forms of synaptic vesicle protein 2.