Property Summary

NCBI Gene PubMed Count 23
PubMed Score 18.49
PubTator Score 15.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.100 8.0e-06
group 3 medulloblastoma 1.600 7.2e-04
atypical teratoid / rhabdoid tumor 1.100 8.6e-05
medulloblastoma, large-cell 1.400 3.6e-06
primitive neuroectodermal tumor 1.500 1.2e-05
non-small cell lung cancer 1.681 2.3e-21
lung cancer 1.300 1.9e-02
nasopharyngeal carcinoma 1.300 1.6e-03
lung carcinoma 1.100 2.6e-25
invasive ductal carcinoma 1.700 1.8e-02
ovarian cancer 1.100 1.1e-03
Breast cancer 1.300 1.6e-06

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (8)

PMID Text
26183527 Our results reveal the regulatory mechanism of LSD1 protein through its lysine methylation by SUV39H2 in human cancer cells
25459750 We also demonstrate that the N324K mutant in the SET domain of SUV39H2 that has been shown to cause an inherited nasal skin disease in Labrador Retrievers renders SUV39H2 inactive
23891737 Expression of JHDM2A was significantly increased but HDAC2, HDAC7, and SUV39H2 were significantly down-regulated in Systemic Sclerosis B cells relative to controls
21896933 genetic association studies in a Finnish population with type I diabetes: The minor T allele of exonic SNP rs17353856 in SUV39H2 is associated with diabetic retinopathy (in a larger meta-analysis); thus an genetic variation may be protective.
21402781 findings suggest that Suv39H1 and Suv39H2 are key hypoxia-induced methyltransferases; their decline in fetal lung during late gestation is critical for epigenetic changes resulting in the developmental induction of SP-A
18231586 The SUV39H2 gene is found in tetrapods (e.g., human, mouse and frog) but not in zebrafish, suggesting that this gene is generated by a tetrapod lineage-specific gene duplication event.
16774942 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16774942 a novel SUV39H2 polymorphism may have a role in lung cancer susceptibility for smokers

AA Sequence

MAAVGAEARGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKDMEYYLVKWKG      1 - 70
WPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRW     71 - 140
QDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLL    141 - 210
AYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEY    211 - 280
VGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTR    281 - 350
LPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN              351 - 410
//

Text Mined References (29)

PMID Year Title
26183527 2015 SUV39H2 methylates and stabilizes LSD1 by inhibiting polyubiquitination in human cancer cells.
25459750 2015 Activity and specificity of the human SUV39H2 protein lysine methyltransferase.
25416956 2014 A proteome-scale map of the human interactome network.
23891737 2013 Aberrant histone modification in peripheral blood B cells from patients with systemic sclerosis.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21896933 2011 Genetic examination of SETD7 and SUV39H1/H2 methyltransferases and the risk of diabetes complications in patients with type 1 diabetes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21402781 2011 Epigenetic regulation of surfactant protein A gene (SP-A) expression in fetal lung reveals a critical role for Suv39h methyltransferases during development and hypoxia.
20084102 2010 Structural biology of human H3K9 methyltransferases.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18231586 2008 Genome-wide survey and developmental expression mapping of zebrafish SET domain-containing genes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16774942 2006 Novel polymorphisms in the SUV39H2 histone methyltransferase and the risk of lung cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15107829 2004 Suv39h histone methyltransferases interact with Smads and cooperate in BMP-induced repression.
14765126 2004 A Suv39h-dependent mechanism for silencing S-phase genes in differentiating but not in cycling cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11094092 2000 Isolation and characterization of Suv39h2, a second histone H3 methyltransferase gene that displays testis-specific expression.
10949293 2000 Regulation of chromatin structure by site-specific histone H3 methyltransferases.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.