Property Summary

Ligand Count 4
NCBI Gene PubMed Count 97
PubMed Score 174.26
PubTator Score 123.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 4.3e-06
osteosarcoma 7950 2.6e-04
lung cancer 4740 1.1e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.689 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.200 1.1e-02
malignant mesothelioma 1.400 4.3e-06
osteosarcoma -1.339 2.6e-04

Gene RIF (43)

AA Sequence

MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYYLVKWRGYPDS      1 - 70
ESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQKAKQRRALRRWEQELNAKRS     71 - 140
HLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVGCECQDCLWAPTGGCCPGASLHKFAYNDQGQ    141 - 210
VRLRAGLPIYECNSRCRCGYDCPNRVVQKGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITS    211 - 280
EEAERRGQIYDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFF    281 - 350
ATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF            351 - 412
//

Text Mined References (104)

PMID Year Title