Property Summary

NCBI Gene PubMed Count 90
PubMed Score 149.44
PubTator Score 123.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 4.3e-06
osteosarcoma 7933 2.6e-04
lung cancer 4473 1.1e-02
Disease Target Count Z-score Confidence
Cancer 2346 3.646 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.400 4.3e-06
osteosarcoma -1.339 2.6e-04
lung cancer 1.200 1.1e-02

Gene RIF (38)

PMID Text
26807716 we describe the synthesis of multidomain 'designer chromatin' templates and their application to dissecting the regulation of human Suv39h1
25204660 PHF2 is likely to repress rDNA transcription by competing with PHF8 for binding of ribosomal DNA promoter and by recruiting H3K9me2/3 methyltransferase SUV39H1.
25063769 These results suggest a model in which SUV39H1 downregulation promotes the establishment of cellular senescence.
24844570 High SUV39H1 expression is associated with hepatocellular carcinoma.
24737085 Suv39H1 induced apoptosis and inhibited cell proliferation in the gastric cancer MGC803 cell line, while decreasing BCL-2, pro-caspase-9, pro-caspase-3 and C-myc. Suv39H1 may be a potential gene target for anti-gastric carcinoma therapy.
24588869 results suggest that Suv39 h1-H3K9me3 epigenetic repression is involved in BZLF1 transcriptional silencing, providing a molecular basis for understanding the mechanism by which EBV latency is maintained
24501407 Short-chain fatty acids from periodontal pathogens suppress EZH2, and SUV39H1 to promote Kaposi's sarcoma-associated herpesvirus replication.
24292684 CRL4B promotes tumorigenesis by coordinating with SUV39H1/HP1/DNMT3A in DNA methylation-based epigenetic silencing
23943221 SUV39H1 expression was upregulated in glioma cell lines and in glioma tissues compared to normal brain, being positively correlated with grade and histological malignancy.
23509280 Methylation of SUV39H1 by SET7/9 results in heterochromatin relaxation and genome instability.
23376847 Results suggest that by regulating JMJD2b and SUV39H1 expression, p53 not only controls transcription but also promotes HC relaxation to accelerate a rate-limiting step in the repair of complex genomes.
23285239 The SUV39H1 chromodomain was shown to recognize histone H3K9me2/3 specifically.
22991213 Our study demonstrated that SUV39H1 up-regulation contributed to hepatocellular carcinoma development and metastasis. The tumor-suppressive miR-125b served as a negative regulator of SUV39H1.
22831836 SUV39H1 generates a gradient of methylation marks at the kinetochore that provides spatiotemporal information essential for accurate chromosome segregation in mitosis.
22562246 Snail interacted with Suv39H1 and recruited it to the E-cadherin promoter for transcriptional repression.
22077140 COUP-TF-interacting protein 2 (CTIP2) abolishes Vpr-mediated stimulation of p21 by cooperating with SUV39H1 and HDAC1/HDAC2 to silence the p21 gene transcription
22036763 The methylation of Sp1 increased the recruitment of Su(var) 3-9 homologue 1(Suv39H1)to the cyclin B1 promoter, resulting in deacetylation and methylation of histone H3 and subsequent downregulation of cyclin B1.
21896933 genetic association studies in a Finnish population with type I diabetes: No associations were found between SNPs in SUV39H1 and the diabetic complications studied.
21504832 SirT1 preserves heterochromatin structure: it modulates Suv39h1 protein levels in stress conditions by preventing MDM2-mediated polyubiquitination at K87.
21402781 findings suggest that Suv39H1 and Suv39H2 are key hypoxia-induced methyltransferases; their decline in fetal lung during late gestation is critical for epigenetic changes resulting in the developmental induction of SP-A
21192791 RFX1 recruits SUV39H1 to the promoter regions of the CD11a and CD70 genes in CD4(+) T cells, thereby regulating local H3K9 tri-methylation levels.
20588255 MDM2 mediates formation of p53-SUV39H1/EHMT1 complex capable of methylating H3-K9 in vitro and on p53 target promoters in vivo.
19581932 CTIP2 is a constitutive p21 gene suppressor that cooperates with SUV39H1 and histone methylation to silence the p21 gene transcription.
19581932 COUP-TF-interacting protein 2 (CTIP2) abolishes Vpr-mediated stimulation of p21 by cooperating with SUV39H1 and HDAC1/HDAC2 to silence the p21 gene transcription
19218236 Results identify DBC1 as a novel cellular inhibitor of SUV39H1 activity, and suggest that DBC1 may be an important regulator of heterochromatin formation and genomic stability by disrupting the SUV39H1-SirT1 complex and inactivating both enzymes.
18619962 Presence of SUV39H1 enhances Evi1 transcriptional repression in a dose dependent manner.
17657744 SUV39H1 is significantly associated with DNMT1, but not with euchromatic promoter methylation in colorectal cancer
17245432 Suv39H1, HP1gamma and histone H3Lys9 trimethylation play a major role in chromatin-mediated repression of integrated HIV-1 gene expression.
17172641 Cabin1 recruits chromatin-modifying enzymes, both histone deacetylases and a histone methyltransferase, to repress myocyte enhancer factor 2 transcriptional activity
16652147 The association between RUNX1, histone deacetylases and SUV39H1 provides a molecular mechanism for repression and possibly gene silencing mediated by RUNX1.
16449642 permanent transcriptional silencing is mediated by the association of PML-RAR with chromatin-modifying enzymes and by recruitment of the histone methyltransferase SUV39H1, responsible for trimethylation of lysine 9 of histone H3
16409643 Interaction between HTLV-1Tax and human SUV39H1 and tethering of SUV39H1 by Tax to the HTLV-1 long terminal repeat
16103223 The recruitment of SUV39H1 to heterochromatin is at least partly independent from that of HP1 and that HP1 transiently interacts with SUV39H1 at heterochromatin.
15220403 Kaposi's Sarcoma-Associated Herpesvirus (KSHV)LANA (Latency-associated nuclear antigen)interacts with SUV39H1 histone methyltransferase, a key component of heterochromatin formation, in KSHV-infected cells
15107829 SUV39H interacts with Smads and cooperates in BMP-induced repression.
12789259 We investigated occupancy of ER-alpha promoter by pRb2/p130-E2F4/5-HDAC1-SUV39 H1-p300 and pRb2/p130-E2F4/5-HDAC1-SUV39H1-DNMT1 complexes, and provided a link between pRb2/p130 and chromatin-modifying enzymes in the regulation of ER-alpha transcription
12711603 Suv39h1 enhanced MBD1-mediated transcriptional repression via MBD, not the C-terminal transcriptional repression domain of MBD1. MBD1 links to histone deacetylases through Suv39h1, causing methylation and deacetylation of histones for gene inactivation
11867540 The human SUV39H1 gene is able to partially rescue Su(var)3-9 silencing defects in Drosophila.

AA Sequence

MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYYLVKWRGYPDS      1 - 70
ESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQKAKQRRALRRWEQELNAKRS     71 - 140
HLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVGCECQDCLWAPTGGCCPGASLHKFAYNDQGQ    141 - 210
VRLRAGLPIYECNSRCRCGYDCPNRVVQKGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITS    211 - 280
EEAERRGQIYDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFF    281 - 350
ATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF            351 - 412
//

Text Mined References (97)

PMID Year Title
26807716 2016 A two-state activation mechanism controls the histone methyltransferase Suv39h1.
25416956 2014 A proteome-scale map of the human interactome network.
25204660 2014 PHD finger protein 2 (PHF2) represses ribosomal RNA gene transcription by antagonizing PHF finger protein 8 (PHF8) and recruiting methyltransferase SUV39H1.
25063769 2014 A role for SUV39H1-mediated H3K9 trimethylation in the control of genome stability and senescence in WI38 human diploid lung fibroblasts.
24844570 2015 Histone lysine methyltransferase SUV39H1 is a potent target for epigenetic therapy of hepatocellular carcinoma.
24737085 2014 Aberrant histone methylation and the effect of Suv39H1 siRNA on gastric carcinoma.
24588869 2014 Role of the histone H3 lysine 9 methyltransferase Suv39 h1 in maintaining Epsteinn-Barr virus latency in B95-8 cells.
24501407 2014 Short-chain fatty acids from periodontal pathogens suppress histone deacetylases, EZH2, and SUV39H1 to promote Kaposi's sarcoma-associated herpesvirus replication.
24292684 2015 CRL4B promotes tumorigenesis by coordinating with SUV39H1/HP1/DNMT3A in DNA methylation-based epigenetic silencing.
23943221 2014 Role of histone lysine methyltransferases SUV39H1 and SETDB1 in gliomagenesis: modulation of cell proliferation, migration, and colony formation.
23695662 2013 Depleting the methyltransferase Suv39h1 improves DNA repair and extends lifespan in a progeria mouse model.
23509280 2013 Methylation of SUV39H1 by SET7/9 results in heterochromatin relaxation and genome instability.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23376847 2014 p53 promotes repair of heterochromatin DNA by regulating JMJD2b and SUV39H1 expression.
23285239 2012 Crystal structure of the human SUV39H1 chromodomain and its recognition of histone H3K9me2/3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22991213 2013 Histone lysine methyltransferase, suppressor of variegation 3-9 homolog 1, promotes hepatocellular carcinoma progression and is negatively regulated by microRNA-125b.
22831836 2012 SUV39H1 orchestrates temporal dynamics of centromeric methylation essential for faithful chromosome segregation in mitosis.
22763435 2012 An epigenetic silencing pathway controlling T helper 2 cell lineage commitment.
22562246 2013 Interaction with Suv39H1 is critical for Snail-mediated E-cadherin repression in breast cancer.
22036763 2011 Hydrogen peroxide induces Sp1 methylation and thereby suppresses cyclin B1 via recruitment of Suv39H1 and HDAC1 in cancer cells.
22020221 2011 The Suv39H1 methyltransferase inhibitor chaetocin causes induction of integrated HIV-1 without producing a T cell response.
21979880 2012 Anti-leukemia activity of chaetocin via death receptor-dependent apoptosis and dual modulation of the histone methyl-transferase SUV39H1.
21896933 2011 Genetic examination of SETD7 and SUV39H1/H2 methyltransferases and the risk of diabetes complications in patients with type 1 diabetes.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21504832 2011 Stabilization of Suv39H1 by SirT1 is part of oxidative stress response and ensures genome protection.
21493592 2011 Histone methyltransferase KMT1A restrains entry of alveolar rhabdomyosarcoma cells into a myogenic differentiated state.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21402781 2011 Epigenetic regulation of surfactant protein A gene (SP-A) expression in fetal lung reveals a critical role for Suv39h methyltransferases during development and hypoxia.
21359677 2011 Deacetylation and methylation at histone H3 lysine 9 (H3K9) coordinate chromosome condensation during cell cycle progression.
21192791 2010 RFX1 regulates CD70 and CD11a expression in lupus T cells by recruiting the histone methyltransferase SUV39H1.
21124070 Trimethylation of histone H3 lysine 4 impairs methylation of histone H3 lysine 9: regulation of lysine methyltransferases by physical interaction with their substrates.
20588255 2010 MDM2 recruitment of lysine methyltransferases regulates p53 transcriptional output.
20562864 2010 Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
20129054 2010 A subset of the histone H3 lysine 9 methyltransferases Suv39h1, G9a, GLP, and SETDB1 participate in a multimeric complex.
20069564 2010 SUV39h- and A-type lamin-dependent telomere nuclear rearrangement.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19881540 2010 Reexpression of epigenetically silenced AML tumor suppressor genes by SUV39H1 inhibition.
19776757 2010 EVI-1 interacts with histone methyltransferases SUV39H1 and G9a for transcriptional repression and bone marrow immortalization.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19581932 2009 p21(WAF1) gene promoter is epigenetically silenced by CTIP2 and SUV39H1.
19218236 2009 Inhibition of SUV39H1 methyltransferase activity by DBC1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18655152 2008 EVI1 recruits the histone methyltransferase SUV39H1 for transcription repression.
18619962 2008 A novel interaction between the proto-oncogene Evi1 and histone methyltransferases, SUV39H1 and G9a.
18485871 2008 Epigenetic control of rDNA loci in response to intracellular energy status.
18096052 2007 Post-translational modifications of histones H3 and H4 associated with the histone methyltransferases Suv39h1 and G9a.
18004385 2007 SIRT1 regulates the histone methyl-transferase SUV39H1 during heterochromatin formation.
17707234 2007 Modulation of p53 function by SET8-mediated methylation at lysine 382.
17657744 2007 Association of the SUV39H1 histone methyltransferase with the DNA methyltransferase 1 at mRNA expression level in primary colorectal cancer.
17245432 2007 Suv39H1 and HP1gamma are responsible for chromatin-mediated HIV-1 transcriptional silencing and post-integration latency.
17245431 2007 Recruitment of chromatin-modifying enzymes by CTIP2 promotes HIV-1 transcriptional silencing.
17172641 2007 Cabin1 represses MEF2 transcriptional activity by association with a methyltransferase, SUV39H1.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16858404 2006 Histone methyltransferase Suv39h1 represses MyoD-stimulated myogenic differentiation.
16818776 2006 The histone methyltransferase Suv39h1 increases class switch recombination specifically to IgA.
16688220 2006 Gfi1b alters histone methylation at target gene promoters and sites of gamma-satellite containing heterochromatin.
16652147 2006 RUNX1 associates with histone deacetylases and SUV39H1 to repress transcription.
16519522 2006 Catalytic properties and kinetic mechanism of human recombinant Lys-9 histone H3 methyltransferase SUV39H1: participation of the chromodomain in enzymatic catalysis.
16449642 2006 Recruitment of the histone methyltransferase SUV39H1 and its role in the oncogenic properties of the leukemia-associated PML-retinoic acid receptor fusion protein.
16409643 2006 SUV39H1 interacts with HTLV-1 Tax and abrogates Tax transactivation of HTLV-1 LTR.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16103223 2005 A glue for heterochromatin maintenance: stable SUV39H1 binding to heterochromatin is reinforced by the SET domain.
15772651 2005 The DNA sequence of the human X chromosome.
15767660 2005 Relationship between histone H3 lysine 9 methylation, transcription repression, and heterochromatin protein 1 recruitment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220403 2004 Accumulation of heterochromatin components on the terminal repeat sequence of Kaposi's sarcoma-associated herpesvirus mediated by the latency-associated nuclear antigen.
15120635 2004 DNMT3B interacts with hSNF2H chromatin remodeling enzyme, HDACs 1 and 2, and components of the histone methylation system.
15107829 2004 Suv39h histone methyltransferases interact with Smads and cooperate in BMP-induced repression.
14765126 2004 A Suv39h-dependent mechanism for silencing S-phase genes in differentiating but not in cycling cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690610 2003 Histone methyltransferases direct different degrees of methylation to define distinct chromatin domains.
12917624 2003 SUV39H1 interacts with AML1 and abrogates AML1 transactivity. AML1 is methylated in vivo.
12867029 2003 Suv39h-mediated histone H3 lysine 9 methylation directs DNA methylation to major satellite repeats at pericentric heterochromatin.
12789259 2003 pRb2/p130-E2F4/5-HDAC1-SUV39H1-p300 and pRb2/p130-E2F4/5-HDAC1-SUV39H1-DNMT1 multimolecular complexes mediate the transcription of estrogen receptor-alpha in breast cancer.
12723694 2003 SU(VAR)3-9 is a conserved key function in heterochromatic gene silencing.
12711675 2003 The DNA methyltransferases associate with HP1 and the SUV39H1 histone methyltransferase.
12711603 2003 Methyl-CpG binding domain 1 (MBD1) interacts with the Suv39h1-HP1 heterochromatic complex for DNA methylation-based transcriptional repression.
12588981 2003 Balance between acetylation and methylation of histone H3 lysine 9 on the E2F-responsive dihydrofolate reductase promoter.
12565857 2003 Self-interaction of heterochromatin protein 1 is required for direct binding to histone methyltransferase, SUV39H1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242305 2002 Association of class II histone deacetylases with heterochromatin protein 1: potential role for histone methylation in control of muscle differentiation.
12101246 2002 Selective interactions between vertebrate polycomb homologs and the SUV39H1 histone lysine methyltransferase suggest that histone H3-K9 methylation contributes to chromosomal targeting of Polycomb group proteins.
11867540 2002 Central role of Drosophila SU(VAR)3-9 in histone H3-K9 methylation and heterochromatic gene silencing.
11788710 2002 Functional and physical interaction between the histone methyl transferase Suv39H1 and histone deacetylases.
11533237 2001 Transcriptional repression by the retinoblastoma protein through the recruitment of a histone methyltransferase.
11484059 2001 Rb targets histone H3 methylation and HP1 to promoters.
11252719 2001 Physical association between the histone acetyl transferase CBP and a histone methyl transferase.
11242053 2001 Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.
11018264 2000 Gene regulation of Wiskott-Aldrich syndrome protein and the human homolog of the Drosophila Su(var)3-9: WASP and SUV39H1, two adjacent genes at Xp11.23.
10949293 2000 Regulation of chromatin structure by site-specific histone H3 methyltransferases.
10873456 2000 Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
10848615 2000 Set domain-dependent regulation of transcriptional silencing and growth control by SUV39H1, a mammalian ortholog of Drosophila Su(var)3-9.
10779362 2000 Structure-function analysis of SUV39H1 reveals a dominant role in heterochromatin organization, chromosome segregation, and mitotic progression.
10671371 2000 Mitotic phosphorylation of SUV39H1, a novel component of active centromeres, coincides with transient accumulation at mammalian centromeres.
10202156 1999 Functional mammalian homologues of the Drosophila PEV-modifier Su(var)3-9 encode centromere-associated proteins which complex with the heterochromatin component M31.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.