Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.23
PubTator Score 3.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Embryonal carcinoma 10 3.27 1.6

Expression

Synonym

Accession Q15527 Q6IBP9 Q96CD1 Surf-2
Symbols SURF-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (2)

AA Sequence

MSELPGDVRAFLREHPSLRLQTDARKVRCILTGHELPCRLPELQVYTRGKKYQRLVRASPAFDYAEFEPH      1 - 70
IVPSTKNPHQLFCKLTLRHINKCPEHVLRHTQGRRYQRALCKYEECQKQGVEYVPACLVHRRRRREDQMD     71 - 140
GDGPRPREAFWEPTSSDEGGAASDDSMTDLYPPELFTRKDLGSTEDGDGTDDFLTDKEDEKAKPPREKAT    141 - 210
DESRRETTVYRGLVQKRGKKQLGSLKKKFKSHHRKPKSFSSCKQPG                            211 - 256
//

Text Mined References (20)

PMID Year Title