Property Summary

NCBI Gene PubMed Count 25
PubMed Score 59.97
PubTator Score 31.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7933 4.0e-06
psoriasis 6685 2.6e-05
ovarian cancer 8491 1.4e-03
lung cancer 4473 4.2e-02
Disease Target Count Z-score Confidence
Vulvovaginal candidiasis 4 3.044 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.500 2.6e-05
osteosarcoma -1.858 4.0e-06
lung cancer 1.100 4.2e-02
ovarian cancer 1.200 1.4e-03

Pathway (1)

Protein-protein Interaction (7)

Gene RIF (15)

PMID Text
25446650 the capacity of hSuv3 DNA unwinding activity might be sensitive to the local availability of specific inorganic cofactors
24770417 SUV3 bridges PNPase and mtPAP to form a transient complex in modulating mt-mRNA poly(A) tail length depending on the mitochondrial matrix Pi level.
23221631 Interaction between PNPase and hSuv3 is essential for efficient mitochondrial RNA degradation.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19864255 The hSuv3p activity was found to be necessary in the regulation of stability of mature, properly formed mRNAs and for removal of the noncoding processing intermediates transcribed from both H and L-strands.
19509288 The complex of hSUV3-hPNPase is an integral entity for efficient degradation of structured RNA and may be the long sought RNA-degrading complex in the mammalian mitochondria.
18678873 SUV3 is essential for maintaining proper mitochondrial function, likely through a conserved role in mitochondrial RNA regulation.
17961633 Human SUV3 protein interacts with human WRN and BLM helicases. Silencing of the SUV3 gene in the human cell line HeLa resulted in elevation of homologous recombination as measured by the frequency of sister chromatid exchange during mitotic cell division.
17373700 Observational study of gene-disease association. (HuGE Navigator)
17352692 Down-regulation of hSUV3 results in cell cycle perturbations and in apoptosis, which is both AIF- and caspase-dependent, and proceeds with the induction of p53.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16176273 Suv3 protein interacts with HBXIP, previously identified as a cofactor of survivin in suppression of apoptosis
15919122 data suggest that hSUV3 is a housekeeping gene with an enhancer region & regulatory elements in basal promoter
15096047 Human SUV3 is an ATP-dependent multiple-substrate helicase; in addition to dsRNA and dsDNA unwinding activity, SUV3-70 and SUV3-83 can unwind heteroduplexes of RNA and DNA.
12466530 Localisation of hSuv3p helicase in the mitochondrial matrix and its preferential unwinding of dsDNA.

AA Sequence

MSFSRALLWARLPAGRQAGHRAAICSALRPHFGPFPGVLGQVSVLATASSSASGGSKIPNTSLFVPLTVK      1 - 70
PQGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFHQAFISFRNYIMQSHSLDVD     71 - 140
IHIVLNDICFGAAHADDLFPFFLRHAKQIFPVLDCKDDLRKISDLRIPPNWYPDARAMQRKIIFHSGPTN    141 - 210
SGKTYHAIQKYFSAKSGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERVTVQPNGKQASHVSCTVEMCS    211 - 280
VTTPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEVEVRDYKRLTP    281 - 350
ISVLDHALESLDNLRPGDCIVCFSKNDIYSVSRQIEIRGLESAVIYGSLPPGTKLAQAKKFNDPNDPCKI    351 - 420
LVATDAIGMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKEGEVTTMNHED    421 - 490
LSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLPDATLSNLIDIFVDFSQVDGQYFVCNMDDFKFSAEL    491 - 560
IQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRNEPLTFAWLRRYIKWPLLPPKNIKDLMDLEA    561 - 630
VHDVLDLYLWLSYRFMDMFPDASLIRDLQKELDGIIQDGVHNITKLIKMSETHKLLNLEGFPSGSQSRLS    631 - 700
GTLKSQARRTRGTKALGSKATEPPSPDAGELSLASRLVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESG    701 - 770
THPKGTRRKKKEPDSD                                                          771 - 786
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25446650 2015 Regulation of the human Suv3 helicase on DNA by inorganic cofactors.
25416956 2014 A proteome-scale map of the human interactome network.
24770417 2014 Helicase SUV3, polynucleotide phosphorylase, and mitochondrial polyadenylation polymerase form a transient complex to modulate mitochondrial mRNA polyadenylated tail lengths in response to energetic changes.
23903356 2013 Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies.
23221631 2013 Human mitochondrial RNA decay mediated by PNPase-hSuv3 complex takes place in distinct foci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19864255 2010 Human mitochondrial RNA turnover caught in flagranti: involvement of hSuv3p helicase in RNA surveillance.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19509288 2009 Human mitochondrial SUV3 and polynucleotide phosphorylase form a 330-kDa heteropentamer to cooperatively degrade double-stranded RNA with a 3'-to-5' directionality.
18678873 2008 Role of SUV3 helicase in maintaining mitochondrial homeostasis in human cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18063578 2008 The layered structure of human mitochondrial DNA nucleoids.
17961633 Interaction of human SUV3 RNA/DNA helicase with BLM helicase; loss of the SUV3 gene results in mouse embryonic lethality.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
17352692 2007 Down-regulation of human RNA/DNA helicase SUV3 induces apoptosis by a caspase- and AIF-dependent pathway.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16176273 2005 Human ATP-dependent RNA/DNA helicase hSuv3p interacts with the cofactor of survivin HBXIP.
15919122 2005 The 5' region of the human hSUV3 gene encoding mitochondrial DNA and RNA helicase: promoter characterization and alternative pre-mRNA splicing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15096047 2004 Purified human SUV3p exhibits multiple-substrate unwinding activity upon conformational change.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14561097 2003 Potent inhibition of NTPase/helicase of the West Nile Virus by ring-expanded ("fat") nucleoside analogues.
12694177 2003 Halogenated benzimidazoles and benzotriazoles as inhibitors of the NTPase/helicase activities of hepatitis C and related viruses.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466530 2002 Localisation of the human hSuv3p helicase in the mitochondrial matrix and its preferential unwinding of dsDNA.
11154739 2000 Sulfotransferases in the bioactivation of xenobiotics.
10453991 1999 A human putative Suv3-like RNA helicase is conserved between Rhodobacter and all eukaryotes.
9925937 1998 Assignment1 of SUPV3L1 to human chromosome band 10q22.1 by in situ hybridization.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.