Property Summary

NCBI Gene PubMed Count 64
PubMed Score 76.67
PubTator Score 40.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 5.5e-08
diabetes mellitus 1663 2.2e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Wolf-Hirschhorn syndrome 32 3.395 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 2.2e-03
ovarian cancer 1.100 5.5e-08

Gene RIF (25)

PMID Text
26903558 A transcription-independent effect of tumor necrosis factor alpha on RNA splicing, mediated by Spt5.
26418880 SPT5 contributes to the up-regulation of hTERT expression and colonic tumor development.
25731772 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
24101474 Data indicate that the Plus3 domain of the Rtf1 subunit mediates Paf1C recruitment to genes by binding a repeating domain within the phosphorylated elongation factor Spt5.
23518577 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
23041311 DSIF Is Selectively Required for mRNA Splicing and Export of NF-kappaB Target Genes.
22422068 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
22355797 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
20471948 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
19952111 he Paf1 complex (Paf1C) and Tat-SF1, two factors implicated previously in elongation control, collaborate with DSIF to facilitate efficient elongation
19860741 crystal structure of hSpt4 in complex with the dimerization region of hSpt5
19742326 RNA polymerase II elongation repression is critically dependent on the C-terminus of Spt5
19210550 These results suggest that one of the functions of Spt5 is to suppress senescence and apoptosis, and that this function is exerted through its association with Spt4 and Pol II.
17962196 These findings reveal a dynamic regulation of DSIF involving either E-box or NF-kappaB depending on the physiological circumstances.
17502349 Upon induction of NF-kappaB, a subset of target genes is regulated differentially by either P-TEFb or DSIF.[P-TEFb, DSIF]
16427012 evolutionarily conserved repetitive heptapeptide motif (consensus = G-S-R/Q-T-P) in the C-terminal region of hSpt5, like the C-terminal domain of RNA Pol II, is highly phosphorylated by P-TEFb
15620346 hSpt5 function in transcription regulation and mRNA capping is essential for a subset of cellular and viral genes and may not be required for global gene expression.
15564463 phosphorylated by P-TEFb kinase during HIV-1 transcription in Tat/TAR dependent manner
11809800 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
11575923 phosphorylation by cdk9; binds pin1 protein after phosphorylation
11112772 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
10757782 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
10454543 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
10393184 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
9514752 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter

AA Sequence

MSDSEDSNFSEEEDSERSSDGEEAEVDEERRSAAGSEKEEEPEDEEEEEEEEEYDEEEEEEDDDRPPKKP      1 - 70
RHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRSGARRLQNLWRDQREEELGEY     71 - 140
YMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPL    141 - 210
QIKSVVAPEHVKGYIYVEAYKQTHVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVR    211 - 280
LKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGG    281 - 350
DVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNF    351 - 420
QPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTG    421 - 490
LIVRVEENFVILFSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQV    491 - 560
LNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLV    561 - 630
ENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRISSPMHPSAGGQRGGFGSPGGGSGGMSRGRGR    631 - 700
RDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPM    701 - 770
YGSQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAF    771 - 840
DDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQS    841 - 910
YHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWV    911 - 980
TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDRE    981 - 1050
ATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA                                    1051 - 1087
//

Text Mined References (74)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26903558 2016 Analysis of Subcellular RNA Fractions Revealed a Transcription-Independent Effect of Tumor Necrosis Factor Alpha on Splicing, Mediated by Spt5.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26418880 2015 Suppressor of Ty homolog-5, a novel tumor-specific human telomerase reverse transcriptase promoter-binding protein and activator in colon cancer cells.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24101474 2013 Structural basis for Spt5-mediated recruitment of the Paf1 complex to chromatin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23041311 2012 DSIF restricts NF-?B signaling by coordinating elongation with mRNA processing of negative feedback genes.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19952111 2009 DSIF, the Paf1 complex, and Tat-SF1 have nonredundant, cooperative roles in RNA polymerase II elongation.
19860741 2009 Crystal structure of the human transcription elongation factor DSIF hSpt4 subunit in complex with the hSpt5 dimerization interface.
19742326 2009 Repression of RNA polymerase II elongation in vivo is critically dependent on the C-terminus of Spt5.
19575011 2009 CDK9 directs H2B monoubiquitination and controls replication-dependent histone mRNA 3'-end processing.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19210550 2009 Role of human transcription elongation factor DSIF in the suppression of senescence and apoptosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17962196 2008 Interplay between E-box and NF-kappaB in regulation of A20 gene by DRB sensitivity-inducing factor (DSIF).
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17502349 2007 Differential regulation of NF-kappaB by elongation factors is determined by core promoter type.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16427012 2006 P-TEFb-mediated phosphorylation of hSpt5 C-terminal repeats is critical for processive transcription elongation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16327805 2006 Dichotomous but stringent substrate selection by the dual-function Cdk7 complex revealed by chemical genetics.
16214896 2005 A negative elongation factor for human RNA polymerase II inhibits the anti-arrest transcript-cleavage factor TFIIS.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15620346 2004 Modulating HIV-1 replication by RNA interference directed against human transcription elongation factor SPT5.
15564463 2004 Coordination of transcription factor phosphorylation and histone methylation by the P-TEFb kinase during human immunodeficiency virus type 1 transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15380072 2004 Locus-specific requirements for Spt5 in transcriptional activation and repression in Drosophila.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15136722 2004 Functional interactions of RNA-capping enzyme with factors that positively and negatively regulate promoter escape by RNA polymerase II.
15060154 2004 Human Spt6 stimulates transcription elongation by RNA polymerase II in vitro.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701750 2004 Dynamics of human immunodeficiency virus transcription: P-TEFb phosphorylates RD and dissociates negative effectors from the transactivation response element.
14580347 2003 Inhibition of P-TEFb (CDK9/Cyclin T) kinase and RNA polymerase II transcription by the coordinated actions of HEXIM1 and 7SK snRNA.
12718890 2003 Methylation of SPT5 regulates its interaction with RNA polymerase II and transcriptional elongation properties.
12676794 2003 The RNA polymerase II elongation complex.
12653964 2003 Structure-function analysis of human Spt4: evidence that hSpt4 and hSpt5 exert their roles in transcriptional elongation as parts of the DSIF complex.
12612062 2003 Human transcription elongation factor NELF: identification of novel subunits and reconstitution of the functionally active complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391174 2002 Subnuclear localization of Ku protein: functional association with RNA polymerase II elongation sites.
11940650 2002 Evidence that negative elongation factor represses transcription elongation through binding to a DRB sensitivity-inducing factor/RNA polymerase II complex and RNA.
11809800 2002 Spt5 cooperates with human immunodeficiency virus type 1 Tat by preventing premature RNA release at terminator sequences.
11575923 2001 The peptidyl-prolyl isomerase Pin1 interacts with hSpt5 phosphorylated by Cdk9.
11553615 2001 A highly purified RNA polymerase II elongation control system.
11145967 2001 Positive transcription elongation factor B phosphorylates hSPT5 and RNA polymerase II carboxyl-terminal domain independently of cyclin-dependent kinase-activating kinase.
11112772 2001 DSIF and NELF interact with RNA polymerase II elongation complex and HIV-1 Tat stimulates P-TEFb-mediated phosphorylation of RNA polymerase II and DSIF during transcription elongation.
10912001 2000 FACT relieves DSIF/NELF-mediated inhibition of transcriptional elongation and reveals functional differences between P-TEFb and TFIIH.
10757782 2000 Domains in the SPT5 protein that modulate its transcriptional regulatory properties.
10454543 1999 Tat-SF1 protein associates with RAP30 and human SPT5 proteins.
10421630 1999 Transcription elongation factor hSPT5 stimulates mRNA capping.
10393184 1999 A novel RNA polymerase II-containing complex potentiates Tat-enhanced HIV-1 transcription.
10199401 1999 NELF, a multisubunit complex containing RD, cooperates with DSIF to repress RNA polymerase II elongation.
10075709 1999 Structure and function of the human transcription elongation factor DSIF.
9857195 1998 Evidence that P-TEFb alleviates the negative effect of DSIF on RNA polymerase II-dependent transcription in vitro.
9790902 1998 Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.
9514752 1998 Role of the human homolog of the yeast transcription factor SPT5 in HIV-1 Tat-activation.
9512541 1998 Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.
9450929 1998 DSIF, a novel transcription elongation factor that regulates RNA polymerase II processivity, is composed of human Spt4 and Spt5 homologs.
9199507 1997 Human Supt5h protein, a putative modulator of chromatin structure, is reversibly phosphorylated in mitosis.
9110174 1997 Large-scale concatenation cDNA sequencing.
8975720 1996 Isolation, sequencing, and mapping of the human homologue of the yeast transcription factor, SPT5.
8619474 1996 A "double adaptor" method for improved shotgun library construction.