Property Summary

NCBI Gene PubMed Count 36
PubMed Score 4.62
PubTator Score 14.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
tuberculosis 1.700 6.1e-06
intraductal papillary-mucinous neoplasm ... -1.100 1.3e-02
sonic hedgehog group medulloblastoma 1.100 2.5e-06

 MGI Phenotype (1)

Gene RIF (10)

PMID Text
25934476 we identified rs41314453 as the main genetic determinant of ADAMTS13 activity, and we present preliminary findings for further associations at the ADAMTS13 and SUPT3H loci.
25860292 significance of the formation PVT1- SUPT3H chimeric gene remains unknown and the overexpression of MYC by ectopic promoter on chromosome 6 may be essential to tumor genesis.
22407027 identified a significant excess of genes with pivotal roles in bone homeostasis, such as PPPT3B and the height associated SUPT3H-RUNX2
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19893584 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19259136 Found evidence of Mendelian Transmission Distortion in the region harboring SUPT3H in one HapMap population.
19259136 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17967894 suggest a novel STAF65gamma-dependent function of STAGA-type complexes in cell proliferation and transcription activation by MYC postloading of TFIID and RNA polymerase II that involves direct recruitment of core Mediator

AA Sequence

MYSPRGSQGRGTAEATANSPSPPIAPSHSRVTFSLSTLHTLSPPPRPFPSVSRAAAQKPHHLHPHILLAG      1 - 70
SAAVPPRVLKAEMNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQ     71 - 140
LINLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSN    141 - 210
NANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSAQYAEFCESRQLSFSKKAS    211 - 280
KFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLVRQDMVTKAGDPFSHAISATFIQYHNSAES    281 - 350
TAACGVEAHSDAIQPCHIREAIRRYSHRIGPLSPFTNAYRRNGMAFLAC                         351 - 399
//

Text Mined References (40)

PMID Year Title
25934476 2015 Genetic variants in the ADAMTS13 and SUPT3H genes are associated with ADAMTS13 activity.
25860292 2015 Identification of SUPT3H as a novel 8q24/MYC partner in blastic plasmacytoid dendritic cell neoplasm with t(6;8)(p21;q24) translocation.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22941190 2012 Common variants at 6p21.1 are associated with large artery atherosclerotic stroke.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22763110 2012 Identification of new susceptibility loci for osteoarthritis (arcOGEN): a genome-wide association study.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22407027 2012 Adaptive evolution of loci covarying with the human African Pygmy phenotype.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19259136 2009 Assessment of transmission distortion on chromosome 6p in healthy individuals using tagSNPs.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18206972 2008 A TFTC/STAGA module mediates histone H2A and H2B deubiquitination, coactivates nuclear receptors, and counteracts heterochromatin silencing.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17967894 2008 STAGA recruits Mediator to the MYC oncoprotein to stimulate transcription and cell proliferation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12660246 2003 c-Myc transformation domain recruits the human STAGA complex and requires TRRAP and GCN5 acetylase activity for transcription activation.
12601814 2003 Novel subunits of the TATA binding protein free TAFII-containing transcription complex identified by matrix-assisted laser desorption/ionization-time of flight mass spectrometry following one-dimensional gel electrophoresis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11564863 2001 Human STAGA complex is a chromatin-acetylating transcription coactivator that interacts with pre-mRNA splicing and DNA damage-binding factors in vivo.
11406595 2001 UV-damaged DNA-binding protein in the TFTC complex links DNA damage recognition to nucleosome acetylation.
11238933 2001 Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes.
10373431 1999 Identification of TATA-binding protein-free TAFII-containing complex subunits suggests a role in nucleosome acetylation and signal transduction.
9885574 1998 The 400 kDa subunit of the PCAF histone acetylase complex belongs to the ATM superfamily.
9787080 1998 Characterization of a human homologue of the Saccharomyces cerevisiae transcription factor spt3 (SUPT3H).
9726987 1998 A human SPT3-TAFII31-GCN5-L acetylase complex distinct from transcription factor IID.
9674425 1998 Histone-like TAFs within the PCAF histone acetylase complex.