Property Summary

NCBI Gene PubMed Count 29
PubMed Score 69.11
PubTator Score 28.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.700 1.1e-02
ependymoma 2.000 2.0e-03
oligodendroglioma 2.300 1.7e-03
osteosarcoma 1.629 3.5e-04
medulloblastoma 2.200 2.2e-04
atypical teratoid / rhabdoid tumor 2.000 1.9e-05
glioblastoma 2.200 3.7e-04
medulloblastoma, large-cell 2.900 1.5e-05
primitive neuroectodermal tumor 1.300 6.5e-04
pediatric high grade glioma 1.400 5.1e-03
aldosterone-producing adenoma -1.030 2.5e-02
subependymal giant cell astrocytoma -1.498 3.9e-02

 GO Function (1)

Protein-protein Interaction (4)

Gene RIF (13)

PMID Text
26842758 FACT is required for TOP1 binding to H3K4me3 at non-B DNA containing chromatin for the site-specific cleavage.
26378236 shRNA knockdown of SUPT16H increases HIV-1 LTR-driven gene expression in HEK293 cells transduced with VSV-G pseudo-typed HIV-1 NL4-3-Luc construct; i.e. HIV-1 is restricted by SUPT16H
23839038 In the absence of FACT complex, SSRP1 and SPT16 mRNAs are unstable and inefficiently translated, making reactivation of FACT function unlikely in normal cells.
22174317 HIV-1 Rev interacting protein, suppressor of Ty 16 homolog (SUPT16H), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SUPT16H is increased by RRE
22031019 SUPT16H and RNF40 are required for proper DNA end resection and timely DNA repair after double-strand breaks.
20599239 HIV-1 Rev interacting protein, suppressor of Ty 16 homolog (SUPT16H), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SUPT16H is increased by RRE
19454010 HIV-1 Rev interacting protein, suppressor of Ty 16 homolog (SUPT16H), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SUPT16H is increased by RRE
18406329 Data establish FACT as the major regulator involved in H2AX exchange process that is modulated by H2AX phosphorylation and Spt16 ADP-ribosylation.
17209051 SSRP1 has Spt16-dependent and -independent roles in regulating gene transcription in human cells.
16977311 yFACT and Set2 oppose one another during transcriptional initiation at a step involving DNA binding by TBP and TFIIA.
16902406 FACT is an integral and conserved component of the endogenous replication machinery, and support a model in which the concerted action of helicase and chromatin-modifying activities promotes chromosome replication.
16713563 Results demonstrate that elongation by RNA polymerase II through the nucleosomal barrier is minimally dependent upon (1) FACT and (2) the recruitment of PAF and the H2B monoubiquitination machinery.
12934006 facilitates RNA polymerase II driven transcription by destabilizing nucleosomal structure so that one histone H2A-H2B dimer is removed during enzyme passage; possesses intrinsic histone chaperone activity and can deposit core histones onto DNA

AA Sequence

MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCD      1 - 70
DKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKD     71 - 140
KFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADE    141 - 210
KVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFK    211 - 280
SYCSNLVRTLMVDPSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGF    281 - 350
GMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTS    351 - 420
VKKKVKNVGIFLKNEDEEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAK    421 - 490
RRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMS    491 - 560
VEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQK    561 - 630
RYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDIL    631 - 700
YNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMER    701 - 770
EMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEV    771 - 840
ELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSLNWTKIMKTIV    841 - 910
DDPEGFFEQGGWSFLEPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDYSKESL    911 - 980
GSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASVHSSGRGSNRGSRHSSAPPKKKRK       981 - 1047
//

Text Mined References (41)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26842758 2016 Chromatin remodeller SMARCA4 recruits topoisomerase 1 and suppresses transcription-associated genomic instability.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23839038 2013 Complex mutual regulation of facilitates chromatin transcription (FACT) subunits on both mRNA and protein levels in human cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22031019 2011 The H2B ubiquitin ligase RNF40 cooperates with SUPT16H to induce dynamic changes in chromatin structure during DNA double-strand break repair.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19214185 2009 FACT facilitates chromatin transcription by RNA polymerases I and III.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18406329 2008 FACT-mediated exchange of histone variant H2AX regulated by phosphorylation of H2AX and ADP-ribosylation of Spt16.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
17209051 2007 Human SSRP1 has Spt16-dependent and -independent roles in gene transcription.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16977311 2006 Opposing roles for Set2 and yFACT in regulating TBP binding at promoters.
16902406 2006 Functional cooperation between FACT and MCM helicase facilitates initiation of chromatin DNA replication.
16713563 2006 Histone H2B monoubiquitination functions cooperatively with FACT to regulate elongation by RNA polymerase II.
16682447 2006 Modulation of nucleosome-binding activity of FACT by poly(ADP-ribosyl)ation.
15616580 2005 Histone modifications defining active genes persist after transcriptional and mitotic inactivation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660563 2004 Nek9, a novel FACT-associated protein, modulates interphase progression.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12934006 2003 FACT facilitates transcription-dependent nucleosome alteration.
12676794 2003 The RNA polymerase II elongation complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393879 2002 p53 serine 392 phosphorylation increases after UV through induction of the assembly of the CK2.hSPT16.SSRP1 complex.
11239457 2001 A DNA damage-induced p53 serine 392 kinase complex contains CK2, hSpt16, and SSRP1.
10912001 2000 FACT relieves DSIF/NELF-mediated inhibition of transcriptional elongation and reveals functional differences between P-TEFb and TFIIH.
10792464 2000 Functional interaction of general transcription initiation factor TFIIE with general chromatin factor SPT16/CDC68.
10421373 1999 The chromatin-specific transcription elongation factor FACT comprises human SPT16 and SSRP1 proteins.
9836642 1998 Requirement of RSF and FACT for transcription of chromatin templates in vitro.
9489704 1998 FACT, a factor that facilitates transcript elongation through nucleosomes.