Property Summary

NCBI Gene PubMed Count 36
PubMed Score 106.85
PubTator Score 138.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.100 1.6e-03
osteosarcoma -1.973 2.6e-04

Protein-protein Interaction (4)

Gene RIF (23)

PMID Text
26171830 This finding suggests the possibility to use oxygen-reactive SO variants in sulfite detoxification, as the loss of SO activity is causing severe neurodegeneration
25314640 Nitrite binds and reduces at the molybdenum site of mammalian sulfite oxidase, which may be allosterically regulated by heme and molybdenum domain interactions, and contributes to the mammalian nitrate-nitrite-NO signaling pathway in human fibroblasts.
24968320 Several mutants of H304 and R309 of SUOX were investigated by steady-state kinetics, laser flash photolysis studies of intramolecular electron transfer (IET), and spectroelectrochemistry.
24106282 combined genetic association studies in women from China/Netherlands/United States: Data suggest that an SNP in SUOX locus (rs705702) and SNPs in other proteins are associated with polycystic ovary syndrome across ethnic differences. [META-ANALYSIS]
23665285 SUOX was decreased and AKR1B10 and CD34 were increased with the stepwise progression of hepatocarcinogenesis.
22975842 effect of mutation of surface residues on the heme domain on intramolecular electron transfer, and steady-state kinetics
22263579 In this study a human sulfite oxidase variant, in which the active site has been modified to alter substrate specificity and activity from sulfite oxidation to nitrate reduction, is compared to chicken sulfite oxidase.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20491442 prepared and purified samples of the wild type and various mutants of human SO that are depleted of chloride. These samples do not exhibit the typical lpH EPR spectrum at low pH but rather exhibit spectra that are characteristic of the blocked species
20063894 Experimental deletions of nonconserved amino acids in the 14-residue interdomain polypeptide tether of sulfite oxidase shorten its length and result in more drastically reduced intramolecular electron transfer rate constants.
18959753 the activity of molybdoenzymes, such as sulfite oxidase, is inhibited by high concentrations of heavy metals in the cell
18529001 EPR study of the Mo(V) center of the pathogenic R160Q mutant confirms the presence of three distinct species whose relative abundances depend upon pH.
18177044 analysis of protein-protein interaction of sulfite oxidase and cytochrome c catalyzing oxidation of sulfite
17940249 Magnetic resonance imaging and MR spectroscopy measurements may help differentiate isolated sulfite oxidase deficiency from hypoxic-ischemic condition in patients in whom this diagnosis is not clinically suspected.
17366837 Observational study of gene-disease association. (HuGE Navigator)
16475804 Analysis of recombinant G473D sulfite oxidase indicated that it is severely impaired both in the ability to bind sulfite and in catalysis, with a second-order rate constant 5 orders of magnitude lower than that of the wild type.
16229463 mutations to charged residues at the equivalent sites most likely cause crucial global or localized structural changes, and expose an alternative docking site that may compete with the Mo domain for docking of the heme
16140720 mutation in SUOX gene in sulfite oxidase deficiency
14729666 the Tyr(343) residue is important for both substrate binding and oxidation of sulfite by sulfite oxidase
14567685 To further assess the role of Arg 160 in human SO, intramolecular electron transfer rates between the reduced heme and oxidized molybdenum centers in the wild type, R160Q, and R160K human SO forms were investigated by laser flash photolysis
12832761 comparison of this structure with other b(5)-type cytochromes reveals distinct structural features present in the sulfite oxidase b(5) domain which promote optimal electron transport between the Moco of sulfite oxidase and the heme of cytochrome c
12763039 Sulfite oxidase gene expression in brain and in other tissues.
12424234 role of conserved tyrosine 343 in intramolecular electron transfer in this enzyme

AA Sequence

MLLLHRAVVLRLQQACRLKSIPSRICIQACSTNDSFQPQRPSLTFSGDNSSTQGWRVMGTLLGLGAVLAY      1 - 70
QDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALY     71 - 140
AVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITP    141 - 210
NPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKG    211 - 280
LEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAY    281 - 350
EMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSI    351 - 420
QELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRL    421 - 490
WQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP                   491 - 545
//

Text Mined References (37)

PMID Year Title
26171830 2015 Oxygen reactivity of mammalian sulfite oxidase provides a concept for the treatment of sulfite oxidase deficiency.
25314640 2015 Sulfite Oxidase Catalyzes Single-Electron Transfer at Molybdenum Domain to Reduce Nitrite to Nitric Oxide.
24968320 2014 Kinetic results for mutations of conserved residues H304 and R309 of human sulfite oxidase point to mechanistic complexities.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24106282 2013 Cross-ethnic meta-analysis of genetic variants for polycystic ovary syndrome.
23665285 2013 SUOX is a promising diagnostic and prognostic biomarker for hepatocellular carcinoma.
22975842 2013 Effects of mutating aromatic surface residues of the heme domain of human sulfite oxidase on its heme midpoint potential, intramolecular electron transfer, and steady-state kinetics.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22885925 2012 Genome-wide association study identifies eight new risk loci for polycystic ovary syndrome.
22263579 2012 Structure-based alteration of substrate specificity and catalytic activity of sulfite oxidase from sulfite oxidation to nitrate reduction.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20491442 2010 Characterization of chloride-depleted human sulfite oxidase by electron paramagnetic resonance spectroscopy: experimental evidence for the role of anions in product release.
20063894 2010 Effects of interdomain tether length and flexibility on the kinetics of intramolecular electron transfer in human sulfite oxidase.
18959753 2008 Heavy metal ions inhibit molybdoenzyme activity by binding to the dithiolene moiety of molybdopterin in Escherichia coli.
18529001 2008 Structural studies of the molybdenum center of the pathogenic R160Q mutant of human sulfite oxidase by pulsed EPR spectroscopy and 17O and 33S labeling.
18198356 2008 A novel susceptibility locus for type 1 diabetes on Chr12q13 identified by a genome-wide association study.
18177044 2008 Layer-by-layer arrangement by protein-protein interaction of sulfite oxidase and cytochrome c catalyzing oxidation of sulfite.
17940249 2007 Magnetic resonance imaging and magnetic resonance spectroscopy in isolated sulfite oxidase deficiency.
17366837 2007 Genetic studies of a cluster of acute lymphoblastic leukemia cases in Churchill County, Nevada.
16475804 2006 The G473D mutation impairs dimerization and catalysis in human sulfite oxidase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16229463 2005 The pathogenic human sulfite oxidase mutants G473D and A208D are defective in intramolecular electron transfer.
16140720 2005 Isolated sulfite oxidase deficiency: a case report with a novel mutation and review of the literature.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14729666 2004 The role of tyrosine 343 in substrate binding and catalysis by human sulfite oxidase.
14567685 2003 Essential role of conserved arginine 160 in intramolecular electron transfer in human sulfite oxidase.
12832761 2003 The 1.2 A structure of the human sulfite oxidase cytochrome b(5) domain.
12763039 2003 Sulphite oxidase gene expression in human brain and in other human and rat tissues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12424234 2003 Role of conserved tyrosine 343 in intramolecular electron transfer in human sulfite oxidase.
12368985 2002 A novel mutation in neonatal isolated sulphite oxidase deficiency.
12112661 2002 Isolated sulfite oxidase deficiency: identification of 12 novel SUOX mutations in 10 patients.
10519592 1999 Isolated sulfite oxidase deficiency: review of two cases in one family.
9600976 1998 Human sulfite oxidase R160Q: identification of the mutation in a sulfite oxidase-deficient patient and expression and characterization of the mutant enzyme.
9428520 1997 Molecular basis of sulfite oxidase deficiency from the structure of sulfite oxidase.
7599189 1995 Molecular cloning of human liver sulfite oxidase.