Property Summary

NCBI Gene PubMed Count 40
PubMed Score 53.64
PubTator Score 30.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
cutaneous lupus erythematosus -1.700 9.7e-05
ependymoma 1.700 8.1e-03
gastric cancer 1.100 8.1e-03
group 3 medulloblastoma 1.300 2.3e-02
intraductal papillary-mucinous adenoma (... 1.300 5.9e-04
intraductal papillary-mucinous carcinoma... 1.300 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 5.8e-03
invasive ductal carcinoma -1.166 5.0e-04
malignant mesothelioma 2.800 2.3e-07
oligodendroglioma 1.200 2.7e-03
osteosarcoma -1.480 1.9e-04
ovarian cancer -1.500 4.6e-05
psoriasis -3.300 9.5e-06
Rheumatoid arthritis 1.600 2.1e-02
spina bifida -2.976 4.6e-02
tuberculosis -1.400 1.2e-03

Protein-protein Interaction (3)

Gene RIF (28)

AA Sequence

MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEA      1 - 70
VGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWI     71 - 140
REQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSR    141 - 210
VYSRDRNQKCDDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPG    211 - 280
KAASGVFWWLGIGWYQFVTLISWLNVFLLTRCLRNICKFLVLLIPLFLLLAGLSLRGQGNFFSFLPVLNW    281 - 350
ASMHRTQRVDDPQDVFKPTTSRLKQPLQGDSEAFPWHWMSGVEQQVASLSGQCHHHGENLRELTTLLQKL    351 - 420
QARVDQMEGGAAGPSASVRDAVGQPPRETDFMAFHQEHEVRMSHLEDILGKLREKSEAIQKELEQTKQKT    421 - 490
ISAVGEQLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQL    491 - 560
LQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNSAL    561 - 630
KLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKG    631 - 700
SQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQM    701 - 770
FQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK                                771 - 812
//

Text Mined References (49)

PMID Year Title