Property Summary

NCBI Gene PubMed Count 60
PubMed Score 57.49
PubTator Score 90.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
DIABETES MELLITUS, INSULIN-DEPENDENT, 5 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7766 4.9e-08
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 106 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1683 4.007 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.953 4.9e-08

Gene RIF (64)

AA Sequence

MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFGGQPISGT      1 - 70
DKPAQLEMEDEDTIDVFQQPTGGVY                                                  71 - 95
//

Text Mined References (61)

PMID Year Title