Property Summary

NCBI Gene PubMed Count 70
PubMed Score 12.49
PubTator Score 53.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.429 6.7e-03
Multiple myeloma 1.965 1.3e-04
psoriasis 1.400 2.0e-04
non primary Sjogren syndrome sicca 1.100 2.3e-02
ovarian cancer 1.600 1.5e-02

 GO Function (1)

Gene RIF (46)

PMID Text
26458400 Small ubiquitin-related modifier 2/3 interacts with p65 and stabilizes it in the cytoplasm in HBV-associated hepatocellular carcinoma.
26223657 Data indicate that small ubiquitin-like modifiers SUMO1, SUMO2, or SUMO3 were found in nuclear speckles.
26223632 Adenovirus E4-ORF3 targets PIAS3 and together with E1B-55K remodels SUMO2/SUMO3 Interactions in the nucleus and at virus genome replication domains.
25533185 The interactions of SLX4 with SUMO and ubiquitin increase its affinity for factors recognizing different DNA lesions or telomeres, helping to direct the SLX4 complex in distinct functional contexts.
25410875 These findings demonstrated a role for the human adenovirus E4-ORF3 protein as a regulator of ubiquitin-like modifications and revealed new SUMO3 substrates induced by E4-ORF3.
25406032 DBC1 modification by Small Ubiquitin-like Modifier 2/3 is crucial for p53 transactivation under genotoxic stress.
25380826 PHD3 SUMOylation occurs at a cluster of four lysines at the C-terminal end of the protein. Furthermore, PHD3 SUMOylation by SUMO2 or SUMO3 contributes to PHD3-mediated repression of HIF1-dependent transcriptional activity.
25047847 In human cells, Ehrlichia chaffeensis TRP120 was selectively conjugated with SUMO2/3 isoforms.
24942926 Expression of SUMO1/2/3 is dramatically enhanced by interferons through an miRNA-based mechanism involving the Lin28/let-7.
24267727 SUMO-2/3 modification near protein-coding gene promoters occurs in order to maintain host immune-related gene unaltered during viral reactivation.
24257756 Stress-induced phosphorylation of Thr486 in c-Myb by p38 mitogen-activated protein kinases attenuates conjugation of SUMO-2/3.
23990779 K-Rta degrades SUMO-2/3 and SUMO-2/3 modified proteins, including promyelocytic leukemia (PML) and K-bZIP.
23751493 We show that human RNF111/Arkadia is a new sumo targeted ligase, which used three adjacent sumo acting motifs for specific recognition of poly-SUMO2/3 chains.
23407422 Overexpression of SUMO-1 and 3 enhanced accumulation of viral DNA, which correlated with an increase in viral replication.
23166591 SUMOylation of HIV-1 IN at positions K46, K136, and K244 by SUMO involves HIV-1 infectivity
23078246 findings show levels of SUMO1- and SUMO2/3-conjugated proteins are elevated in astrocytic tumors; findings highlight the pivotal role of SUMO conjugation in DNA damage repair processes
23077236 Data suggest that SUMO1 and SUMO2/3 are highly enriched in neck area of sperm; SUMOs are also associated with redundant nuclear envelope, flagella, and some sperm head regions.
22942423 SUMO3-conjugated IRF8 shows reduced mobility in live nuclei and binds poorly to the interleukin (IL)12p40 gene.
22492558 Only two missense variants were identified, both within SUMO3, however, these were both present in multiple affected individuals and a similar number of controls.
22306003 SUMO-2/3 conjugates accumulating under the heat shock or MG132 treatment result largely from new protein synthesis.
22296450 The 15q24 microdeletion may thus represent the first genetic hit to initiate leukaemogenesis and implicates PML and SUMO3 as novel components of the leukaemogenic network in TMD/AMKL.
22291911 sumoylation of proteins during keratinocyte differentiation is a complex process which likely reflects and contributes to the biochemical changes that drive differentiation.
21900752 Conjugation of SUMO-2/3 to p53 correlates with a reduction of both activation and repression of a subset of p53-target genes.
21878624 Loop 1 insertion in SENP6 and SENP7 as a platform to discriminate between SUMO1 and SUMO2/3 isoforms in this subclass of the SUMO protease family.
21454548 SUMOylation of HIV-1 IN at positions K46, K136, and K244 by SUMO involves HIV-1 infectivity
21291420 The expression of SUMO2 and SUMO3 is regulated differently by reactive oxygen species.
20181954 SENP3-mediated de-conjugation of SUMO2/3 from promyelocytic leukemia is correlated with accelerated cell proliferation under mild oxidative stress.
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19919826 these findings suggest an expanded role of p150 as a SUMO2/3-interacting factor, and raise the intriguing possibility that p150 plays a role in promoting delivery of SUMO2/3 or SUMO2/3-modified proteins (or both) on chromatin fibers during replication.
19635839 Results show that nuclear actin is modified by SUMO2 and SUMO3 and that computational modeling and site-directed mutagenesis identified K68 and K284 as critical sites for SUMOylating actin.
19597476 HSP27-induced HSF1 modification by SUMO-2/3 takes place downstream of the transcription factor phosphorylation on S303 and S307 and does not affect its DNA-binding ability
19029252 CTCF protein can be posttranslationally modified by the small ubiquitin-like protein SUMO.
18946085 Data describe a mitotic SUMO2/3 conjugation-deconjugation cycle of Borealin and further assign a regulatory function of RanBP2 and SENP3 in the mitotic SUMO pathway.
18842587 the acidic stretch of the SIM of MCAF1 plays an important role in the binding to SUMO-3.
18708356 BLM, the RecQ DNA helicase mutated in Bloom syndrome, is preferentially modified by SUMO-2/3 both in vitro and in vivo
18694876 SUMO-2/3, though expressed similarly to SUMO-1, may function separately and independently during pachytene in men.
18565875 SUMO-2/3 conjugation and the ubiquitin-proteasome system are tightly integrated and act in a cooperative manner.
18374647 SUMOylation is a key regulator of the mammalian cell cycle, with SUMO-2/3 modification of different proteins regulating distinct processes.
17164289 sumoylation has a role in keratinocyte differentiation
17012228 p53 and pRB can be sumoylated by SUMO-2/3 in vivo, and such modification of p53 and pRB may play roles in premature senescence and stress response
16626738 Results describe the crystal structure of the central region of thymine-DNA glycosylase conjugated to SUMO-3.
16154602 SMT3A expression was down-regulated in association with DNA synthesis induction after X-ray irradiation in basal cell nevus syndrome cells.
16055710 c-Fos/c-Jun AP-1 dimer activity is downregulated by SUMO-1, SUMO-2, and SUMO-3
15723523 Dissimilarities between SUMO-3 and SUMO-1 in tertiary structure.
15456902 SUMO-1 shows patterns of utilization that are clearly discrete from the patterns of SUMO-2 and -3 throughout the cell cycle
12511558 SUMO3 has a role in PIASy-enhanced modification of C-EPB alpha

AA Sequence

MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD      1 - 70
TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF                                          71 - 103
//

Text Mined References (76)

PMID Year Title
26458400 2015 Small ubiquitin-related modifier 2/3 interacts with p65 and stabilizes it in the cytoplasm in HBV-associated hepatocellular carcinoma.
26223657 2015 Small Ubiquitin-like Modifier Alters IFN Response.
26223632 2015 Adenovirus E4-ORF3 Targets PIAS3 and Together with E1B-55K Remodels SUMO Interactions in the Nucleus and at Virus Genome Replication Domains.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25533185 2015 Noncovalent interactions with SUMO and ubiquitin orchestrate distinct functions of the SLX4 complex in genome maintenance.
25416956 2014 A proteome-scale map of the human interactome network.
25410875 2015 Proteomic analysis of ubiquitin-like posttranslational modifications induced by the adenovirus E4-ORF3 protein.
25406032 2014 Modification of DBC1 by SUMO2/3 is crucial for p53-mediated apoptosis in response to DNA damage.
25380826 2015 PHD3-SUMO conjugation represses HIF1 transcriptional activity independently of PHD3 catalytic activity.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25047847 2014 Ehrlichia chaffeensis exploits host SUMOylation pathways to mediate effector-host interactions and promote intracellular survival.
24942926 2014 Interferon controls SUMO availability via the Lin28 and let-7 axis to impede virus replication.
24267727 2013 The chromatin modification by SUMO-2/3 but not SUMO-1 prevents the epigenetic activation of key immune-related genes during Kaposi's sarcoma associated herpesvirus reactivation.
24257756 2013 Stress-induced phosphorylation of Thr486 in c-Myb by p38 mitogen-activated protein kinases attenuates conjugation of SUMO-2/3.
24105744 2013 A SUMO-dependent interaction between Senataxin and the exosome, disrupted in the neurodegenerative disease AOA2, targets the exosome to sites of transcription-induced DNA damage.
23990779 2013 Kaposi's sarcoma-associated herpesvirus K-Rta exhibits SUMO-targeting ubiquitin ligase (STUbL) like activity and is essential for viral reactivation.
23751493 2013 RNF111/Arkadia is a SUMO-targeted ubiquitin ligase that facilitates the DNA damage response.
23407422 2013 Small ubiquitin-related modifier (SUMO) pathway-mediated enhancement of human cytomegalovirus replication correlates with a recruitment of SUMO-1/3 proteins to viral replication compartments.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23078246 2013 Small ubiquitin-like modifier 1-3 conjugation [corrected] is activated in human astrocytic brain tumors and is required for glioblastoma cell survival.
23077236 2013 Localization and identification of sumoylated proteins in human sperm: excessive sumoylation is a marker of defective spermatozoa.
22942423 2012 The small ubiquitin-like modifier-deconjugating enzyme sentrin-specific peptidase 1 switches IFN regulatory factor 8 from a repressor to an activator during macrophage activation.
22878415 2012 Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions.
22492558 2012 Investigation of SUMO pathway genes in the etiology of nonsyndromic cleft lip with or without cleft palate.
22306003 2012 SUMO-2/3 conjugates accumulating under heat shock or MG132 treatment result largely from new protein synthesis.
22296450 2012 A 15q24 microdeletion in transient myeloproliferative disease (TMD) and acute megakaryoblastic leukaemia (AMKL) implicates PML and SUMO3 in the leukaemogenesis of TMD/AMKL.
22291911 2012 Analysis of global sumoylation changes occurring during keratinocyte differentiation.
21965678 2011 SUMOylation and SUMO-interacting motif (SIM) of metastasis tumor antigen 1 (MTA1) synergistically regulate its transcriptional repressor function.
21900752 2011 MDM2 promotes SUMO-2/3 modification of p53 to modulate transcriptional activity.
21878624 2011 Swapping small ubiquitin-like modifier (SUMO) isoform specificity of SUMO proteases SENP6 and SENP7.
21291420 2011 SUMO2 and SUMO3 transcription is differentially regulated by oxidative stress in an Sp1-dependent manner.
21269460 2011 Initial characterization of the human central proteome.
20181954 2010 SENP3-mediated de-conjugation of SUMO2/3 from promyelocytic leukemia is correlated with accelerated cell proliferation under mild oxidative stress.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19919826 2010 The p150 subunit of CAF-1 causes association of SUMO2/3 with the DNA replication foci.
19635839 2009 SUMOylation of nuclear actin.
19597476 2009 Heat shock protein 27 is involved in SUMO-2/3 modification of heat shock factor 1 and thereby modulates the transcription factor activity.
19050011 2009 Dynamic interaction between WT1 and BASP1 in transcriptional regulation during differentiation.
19029252 2009 The CTCF insulator protein is posttranslationally modified by SUMO.
18946085 2009 RanBP2 and SENP3 function in a mitotic SUMO2/3 conjugation-deconjugation cycle on Borealin.
18842587 2008 Structure of the small ubiquitin-like modifier (SUMO)-interacting motif of MBD1-containing chromatin-associated factor 1 bound to SUMO-3.
18708356 2008 Small ubiquitin-related modifier (SUMO) binding determines substrate recognition and paralog-selective SUMO modification.
18694876 2008 Small ubiquitin-related modifier (SUMO)-1, SUMO-2/3 and SUMOylation are involved with centromeric heterochromatin of chromosomes 9 and 1 and proteins of the synaptonemal complex during meiosis in men.
18565875 2008 The ubiquitin-proteasome system is a key component of the SUMO-2/3 cycle.
18538659 2008 Mechanism and consequences for paralog-specific sumoylation of ubiquitin-specific protease 25.
18374647 2008 SUMO-2/3 modification and binding regulate the association of CENP-E with kinetochores and progression through mitosis.
17696781 2007 Sumoylation of the zinc finger protein ZXDC enhances the function of its transcriptional activation domain.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17164289 2007 Sumoylation dynamics during keratinocyte differentiation.
17012228 2006 Expression of SUMO-2/3 induced senescence through p53- and pRB-mediated pathways.
17000644 2006 Distinct and overlapping sets of SUMO-1 and SUMO-2 target proteins revealed by quantitative proteomics.
16626738 2006 Crystal structure of SUMO-3-modified thymine-DNA glycosylase.
16608850 2006 Characterization of a family of nucleolar SUMO-specific proteases with preference for SUMO-2 or SUMO-3.
16553580 2006 The structure of SENP1-SUMO-2 complex suggests a structural basis for discrimination between SUMO paralogues during processing.
16154602 2005 Down-regulation of SMT3A gene expression in association with DNA synthesis induction after X-ray irradiation in nevoid basal cell carcinoma syndrome (NBCCS) cells.
16055710 2005 Down-regulation of c-Fos/c-Jun AP-1 dimer activity by sumoylation.
15723523 2005 Solution structure of human SUMO-3 C47S and its binding surface for Ubc9.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15487983 2005 Mapping residues of SUMO precursors essential in differential maturation by SUMO-specific protease, SENP1.
15456902 2004 Distinct in vivo dynamics of vertebrate SUMO paralogues.
15296745 2004 A basis for SUMO protease specificity provided by analysis of human Senp2 and a Senp2-SUMO complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12924945 2003 Role of an N-terminal site of Ubc9 in SUMO-1, -2, and -3 binding and conjugation.
12810706 2003 Modification of CCAAT/enhancer-binding protein-beta by the small ubiquitin-like modifier (SUMO) family members, SUMO-2 and SUMO-3.
12511558 2003 A synergy control motif within the attenuator domain of CCAAT/enhancer-binding protein alpha inhibits transcriptional synergy through its PIASy-enhanced modification by SUMO-1 or SUMO-3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383504 2002 Molecular features of human ubiquitin-like SUMO genes and their encoded proteins.
11997515 2002 Desumoylation activity of Axam, a novel Axin-binding protein, is involved in downregulation of beta-catenin.
11451954 2001 Polymeric chains of SUMO-2 and SUMO-3 are conjugated to protein substrates by SAE1/SAE2 and Ubc9.
10830953 2000 The DNA sequence of human chromosome 21.
10692421 2000 Functional heterogeneity of small ubiquitin-related protein modifiers SUMO-1 versus SUMO-2/3.
9119407 1997 SMT3A, a human homologue of the S. cerevisiae SMT3 gene, maps to chromosome 21qter and defines a novel gene family.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.