Property Summary

NCBI Gene PubMed Count 338
PubMed Score 474.21
PubTator Score 466.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 1.6e-03

 OMIM Phenotype (1)

Gene RIF (205)

PMID Text
26578773 PML IV/ARF interaction enhances p53 SUMO-1 conjugation, activation, and senescence.
26563097 Roles for SUMO in pre-mRNA processing
26549688 SUMOylation at specific sites on PXR protein are involved in enhancement of transcription function of this receptor.
26449956 Knockdown of SUMO1 using specific siRNA influenced the accumulation of lipid droplets and reduced HCV replication.
26403314 Data identify PDGFRbeta as the hub gene in both inflammatory (IBC) and non-inflammatory breast neoplasm (non-IBC) and SUMO1 and COL1A1 the respective key genes for IBC and non-IBC suggesting they might play important role in the pathogenesis of the neoplasm.
26400283 High DAP1 expression is associated with a 4-fold increase in the risk of lymph node metastases in squamous cell carcinoma of the oral cavity.
26244656 SUMO-1 modification may affect the transcriptional activity of EGFR
26223657 Data indicate that small ubiquitin-like modifiers SUMO1, SUMO2, or SUMO3 were found in nuclear speckles.
26212320 The LKB1 K178R SUMO mutant had defective AMPK signaling and mitochondrial function, inducing death in energy-deprived cells.
26060329 Data suggest that small ubiquitin-related modifier protein SUMO1 modification of the promyelocytic leukemia protein (PML) RING domain promotes SUMO2 conjugation to Lys160.
25880753 These results confirm that the SUMO machinery is involved in TRIM5alpha-mediated retroviral restriction, and demonstrate that TRIM5alpha is a SUMO 1 and SUMO 2 substrate.
25867063 Akt directly phosphorylates Ubc9 at Thr35 and phosphorylates SUMO1 at Thr76. Ubc9 phosphorylation at Thr35 promotes Ubc9 thioester bond formation and SUMO1 phosphorylation at Thr76 stabilizes the SUMO1 protein.
25800734 reveals an unexpected role of SUMO-1 and SAFB in the stimulatory coupling of promoter binding, transcription initiation and RNA processing
25497731 The crystal structures of SUMO1 bound to unphosphorylated and tetraphosphorylated PML-SUMO-interacting motifs peptides indicate that three phosphoserines directly contact specific positively charged residues of SUMO1.
25484073 SUMO1 accelerates the accumulation of autophagic vacuoles and promotes Abeta production.
25391294 Under cell-free in vitro conditions, p35 is covalently modified by SUMO1. Sumoylation is a likely candidate mechanism for the rapid modulation of p35/Cdk5 activity in physiological situations as well as in disease.
25378699 Overexpression of SUMO-1 decreased phosphorylated GSK-3beta at Ser-9. Mutagenesis of tau at K340R or inhibition of tau SUMOylation by ginkgolic acid abolishes the effect of SUMO-1.
25241153 MDM2 and SUMO-1 proteins are up-regulated in actinic cheilitis and lip cancer.
25183729 These results show that DAP1 is a key regulator, of the induction of apoptosis and reduction of autophagy by subtilase cytotoxin (SubAB).
25118297 Identify DRP1, RanGAP1 and topoisomerase IIa as targets of SUMO1 in human ejaculated sperm, giving more insights on the role of SUMO1-ylation in sperm morphology and motility.
25114211 identified 295 SUMO1 and 167 SUMO2 sites on endogenous substrates of HeLa cells
25111678 findings provide empirical evidence that SUMO1 genetic polymorphisms might be strongly involved in the etiology of NSCL/P, especially for rs12470401 T>C, rs16838917 A>G, rs12470529 A>G, and rs7572505 A>G polymorphisms.
25074923 SUMO potentiates the inhibition of protein synthesis induced by PKR in response to dsRNA.
24953629 SUMO1 modification stabilizes CDK6 protein and drives the cell cycle and glioblastoma progression.
24942926 Expression of SUMO1/2/3 is dramatically enhanced by interferons through an miRNA-based mechanism involving the Lin28/let-7.
24819975 SUMO-1 modification of RARA is a potent mechanism for balancing proliferation and differentiation by controlling the stability of RARA in cancer cells.
24753249 Modification of TDG by small ubiquitin-like modifier (SUMO) proteins weakens its binding to abasic DNA.
24656128 SUMO chain-induced dimerization activates RNF4.
24344134 PIASxalpha is a novel SUMO E3 ligase for PTEN, and it positively regulates PTEN protein level in tumor suppression.
24309115 The mitosis-dependent dynamic SUMO-1 modification of NuMA might contribute to NuMA-mediated formation and maintenance of mitotic spindle poles during mitosis.
24286314 The mutation of the sumoylation site (Lys137) of PTBP2 markedly inhibited its modification by SUMO1.
24174529 SUMO participates in transcriptional repression as both a covalent modification and through non-covalent interactions with E2 and E3 enzymes.
24072711 The SUMO1-E67 interacting loop peptide is an allosteric inhibitor of the dipeptidyl peptidases 8 and 9.
23996296 SUMO1P3 was significantly up-regulated in gastric cancer tissues.
23407422 Overexpression of SUMO-1 and 3 enhanced accumulation of viral DNA, which correlated with an increase in viral replication.
23395904 A previously undescribed SIRT1/Ubc9 regulatory axis in the modulation of protein sumoylation and the hypoxia response.
23382880 our study demonstrated that SUMOylation on K166, the first described residue of SUMO-1 modification of ataxin-3, partially increased the stability of mutant-type ataxin-3, and the rate of apoptosis arisen from the cytotoxicity of the modified protein
23369348 These results suggest that the rhTRIM5alpha B30.2/SPRY domain is not only important for the recognition of the HIV-1 CA, but it is also important for its association with SUMO-1 or SUMO-1 modified proteins.
23350884 The expression of SUMO-1 in OLP was similar to normal mucosa and inflammatory fibrous hyperplasia, suggesting that alterations of this protein occur at later stages of carcinogenesis
23243001 SUMO1-modification of the lamin A tail is reduced by two familial partial lipodystrophy-causing mutations, G465D and K486N.
23229893 SUMO-1 co-localizes with a subset of lysosomes in neurodegenerative diseases with glial protein aggregates.
23160374 enhancement of ERalpha transcriptional activity exerted by wild-type but not mutant (2K/2R) CLOCK in response to estrogen indicated that sumoylation of CLOCK may have an important role in estrogen-dependent signaling
23152501 DPP9 binds to SUMO1 through a novel SUMO1 interacting motif.
23092970 SUMO modification plays a crucial role in the control of hnRNP-K's function as a p53 co-activator in response to DNA damage by UV
23078246 findings show levels of SUMO1- and SUMO2/3-conjugated proteins are elevated in astrocytic tumors; findings highlight the pivotal role of SUMO conjugation in DNA damage repair processes
23077236 Data suggest that SUMO1 and SUMO2/3 are highly enriched in neck area of sperm; SUMOs are also associated with redundant nuclear envelope, flagella, and some sperm head regions.
22975420 SUMO-1 is induced by amyloid-beta peptides in cultured cortical neurons and H4 cells. SUMO-1 increases BACE1 and amyloid-beta.
22905217 SUMO modification of Stra13 is required for repression of cyclin D1 expression and cellular growth arrest
22895527 SUMOylation of HIV-1 IN at positions K46, K136, and K244 by SUMO involves HIV-1 infectivity
22731716 Stable expression of inducible GFP-SUMO-1 in MDCK cells resulted in decreased levels of claudin-2 protein by immunoblot and decreased claudin-2 membrane expression
22713753 SUMO1 modification is required for PTEN tumour suppressor function by controlling PTEN membrane association and regulation of the phosphatidylinositol-3 kinase/AKT pathway.
22651256 analysis of regulation of small ubiquitin-like modifier-1, nuclear receptor coreceptor, histone deacetylase 3, and peroxisome proliferator-activated receptor-gamma in human adipose tissue
22612509 In the present study, the proportions of intranuclear inclusion positive for NEDD8, NUB1 and SUMO-1 were significantly lower in glial cells than in neurons.
22586270 ERbeta SUMO-1 modification occurs on a unique nonconsensus sumoylation motif which becomes fully competent upon phosphorylation of its contained serine residue.
22403398 Data show that the SAE2 subunit of the small ubiquitin-like modifier (SUMO) E1 is autoSUMOylated at residue Lys-236, and SUMOylation was catalyzed by Ubc9 at several additional Lys residues surrounding the catalytic Cys-173 of SAE2.
22227369 This work indicates that Zac1 functions are regulated, at least in part, via non-covalent interactions with SUMO-1 for the induction of p21, which is important for the modulation of apoptosis.
22194619 Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
22164242 SUMOylation may significantly contribute to modulation of JNK activation and contribute to cell death in oxidative stress conditions
21983723 SUMO-1 modification had a toxic effect which could increase the apoptosis induced by wild type overexpression and mutation of alpha-synuclein.
21968017 rpS3 is covalently modified by SUMO-1 and this post-translational modification regulates rpS3 function by increasing rpS3 protein stability.
21957283 The authors demonstrate that vaccinia virus E3 interacts with SUMO1 through a small ubiquitin-like modifier (SUMO)-interacting motif (SIM).
21931855 Data reveal highly complex SUMO-1 regulatory mechanisms driven by SUMOylation to modulate Nkx2-5 activity.
21900893 levels of SUMO1 and the SUMOylation of SERCA2a itself were greatly reduced in failing hearts
21878624 Loop 1 insertion in SENP6 and SENP7 as a platform to discriminate between SUMO1 and SUMO2/3 isoforms in this subclass of the SUMO protease family.
21683690 These results suggested that SUMO1 plays an important role in modulation of NOX2 activity required for ROS generation.
21641618 Proteasomal dysfunction causes accumulation of SUMOylated alpha-synuclein and subsequently its aggregation, pointing to the contribution of this posttranslational modification to inclusion bodies in alpha-synucleinopathies.
21563299 Sequence analysis of DNA from newborn screening blood spots revealed a single 16 bp substitution in the SUMO-1 regulatory promoter of a patient displaying both oral-facial clefts and atrial septal defects
21545853 Study has identified that nNOS is posttranslationally modified by SUMO-1.
21527745 Suggest that SUMO-1 is an important regulatory mechanism that indirectly represses the production of reactive oxygen species via NADPH oxidase to ameliorate cellular stress.
21490953 The SUMO-1-mediated block of murine leukemia virus is mediated by human TRIM5alpha. CA mutations altering the SUMO conjugation sites reduce TRIM5alpha restriction.
21454548 SUMOylation of HIV-1 IN at positions K46, K136, and K244 by SUMO involves HIV-1 infectivity
21336309 oncogenic Ras efficiently activates the ERK pathway both by activating Raf and by inhibiting MEK SUMOylation, thereby inducing carcinogenesis
21284855 SUMO-1 increases the enzymatic turnover of TDG (thymine-DNA glycosylase) by overcoming the product-inhibition of TDG on apurinic sites. The mechanism involves a competitive DNA binding activity of SUMO-1 towards the regulatory domain of TDG.
21268066 SUMOylation of DLX3 by SUMO1 promotes its transcriptional activity.
21192925 These results suggest that SUMO interaction motif-mediated HIPK2 targeting to PML-NBs is crucial for HIPK2-mediated p53 activation and induction of apoptosis.
21189065 Risk factors identified in this study may provide a better understanding of the etiological role of SUMO1 gene in the incidence of nonsyndromic orofacial clefts.
21123177 SUMO-1 overexpressing cells demonstrated focal clustering of glycolytic enzymes in response to hypoxia
21047957 The authors demonstrate that NS1 of the highly pathogenic avian influenza A/Duck/Hubei/L-1/2004 (H5N1) virus interacts with human Ubc9 and SUMO1 is conjugated to H5N1 NS1 in both transfected and infected cells.
21044801 SUMO1 gene genetic variation do not play a significant role in the development of cleft palate and cleft lip development in patients from Central Europe.
21044801 Observational study of gene-disease association. (HuGE Navigator)
21039605 show that SUMO1 is mainly present in live spermatozoa. In conclusion, sumoylation of human spermatozoa may be involved in the regulation of motility
20932933 Dysregulated SUMOylation has been implicated in several neurodegenerative disorders, heart disease and cancer.
20881090 The authors demonstrate that LANA2 is covalently conjugated to SUMO1 and SUMO2 both in vitro and in latently KSHV-infected B-cells.
20738159 the etiological role of SUMO1 in nonsyndromic cleft lip with or without cleft palate incidence
20738159 Observational study of gene-disease association. (HuGE Navigator)
20711444 Pias1-dependent SUMOylation influences Gli protein activity
20661221 Studies define an important role of PIASy in hypoxia signaling through promoting HIF1alpha SUMOylation.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20584900 a novel mechanism by which SUMO interaction modulates the activity of transcription factors
20544801 Observational study of gene-disease association. (HuGE Navigator)
20533263 Neither overexpression of wild-type and A53T pathogenic mutant alpha-synuclein, nor sumoylation by SUMO-1 of alpha-synuclein, affected the subcellular localization in the mitochondria.
20519406 Human herpesvirus 5 IE2 bound physically to SUMO-1 through a SUMO-interacting motif (SIM).
20501649 the Zn(2+) motif of E1 has a role in SUMO adenylation
20145208 there is a SUMOylation-mediated mechanism of IGF-1R signaling that has potential implications for gene regulation
19955185 hPPARalpha SUMOylation on lysine 185 down-regulates its trans-activity through the selective recruitment of NCoR
19937600 Observational study of gene-disease association. (HuGE Navigator)
19917317 The data obtained in this study demonstrate that the non-structural influenza A viral protein NS1A is an authentic SUMO target.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19889771 S-HDAg is a small ubiquitin-like modifier 1 (SUMO1) target protein.
19859084 tumors arising from the UBC9 10920CG genotype were associated with higher prevalence of SUMO1 overexpression compared with those with CC genotype (78 vs 31%, P=0.021).
19859084 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19680224 SENP3 is a redox sensor that regulates HIF-1 transcriptional activity under oxidative stress through the de-SUMOylation of p300
19596686 Data suggest that the nucleolus is the key organelle in which SUMO-1 conjugates accumulate in response to proteasome inhibition.
19565496 SUMO-1 is involved in the activation of both rheumatoid arthritis fibroblast-like synoviocytes (FLS) and prosthesis-loosening FLS by preventing these cells from undergoing apoptosis.
19497852 SUMO modification of the androgen receptor attenuates polyglutamine-mediated aggregation
19384898 The high probability of the putative sumoylation sites predicted in the heterogeneous nuclear ribonucleoprotein A2/B1 isoform B1 and UDG suggests that they might be the novel sumoylation substrates.
19380586 sumoylation- and Sumo binding domain-dependent PML oligomerization within nuclear bodies is sufficient for RNF4-mediated PML degradation
19297320 Adenosine signaling mediates SUMO-1 modification of IkappaBalpha during hypoxia and reoxygenation.
19287951 BRCA1/1a/1b fine tunes the dynamic complex interplay between SUMO-dependent/independent activities of Ubc9 on E2-induced ERalpha activation/repression and degradation in breast cancer cells
19251700 The SUMOylation of both AhRR and Arnt is important for the efficient transcriptional repression activity of the AhRR/Arnt heterodimer
19041634 RORalpha is SUMOylated by both SUMO-1 and SUMO-2.
19029252 CTCF protein can be posttranslationally modified by the small ubiquitin-like protein SUMO.
18983974 These data are the first to suggest a role for SUMO1 gene variation in human non-syndromic cleft lip with or without cleft palate development.
18983974 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18836734 Data show that SUMO-1-associated inclusion body proteins are immunocaptured using an anti-SUMO-1 antibody in the intranuclear inclusion bodies from brain tissue of a case with familial neuronal intranuclear inclusion disease.
18762900 S270P mutation affects DNMT3B functions via specific, non-covalent interaction with SUMO-1.
18707152 unambiguously show that serine 2 of the endogenous SUMO-1 N-terminal protrusion is phosphorylated in vivo using very high mass accuracy mass spectrometry at both the MS and the MS/MS level and complementary fragmentation techniques
18694876 Our data suggest that SUMO-1 may be involved in maintenance and/or protection of the autosomal synaptonemal complex in men.
18684836 SUMOylation of HIV-1 IN at positions K46, K136, and K244 by SUMO involves HIV-1 infectivity
18660489 Observational study of gene-disease association. (HuGE Navigator)
18592385 We show that, during late pachynema, SUMO-1 appears on the constitutive heterochromatin, but is excluded from the XY body facultative heterochromatin.
18579533 SUMO1 modification serves as a positive regulator for Nkx2.5 transcriptional activity
18408014 SATB1 has a role in controlling transcription in immune cells during normal cell functions or in assisting in efficient and rapid clearance of nonfunctional or potentially damaging immune cells through its action with SUMO
18404132 SUMO1 participates in the modulation of ER-mediated CRH mRNA expression which may be important for the regulation of the stress response.
18211901 the transcription repressor function of RIP140 is modulated by SUMOylation
18093978 TRAF6 is modified by small ubiquitin-related modifier-1, interacts with histone deacetylase 1, and represses c-Myb-mediated transactivation.
18063693 Sumoylation negatively affects estrogen-related receptor-alpha and -gamma transcriptional activity through a synergy control motif.
17976381 Topors enhances the formation of high-molecular weight SUMO-1 conjugates of TOP1 in a reconstituted in vitro system and also in human osteosarcoma cells
17932034 SUMO-specific protease 1 transcription is induced by the androgen receptor in prostate cancer cells
17671677 overexpression of Mdm2 caused by overexpression of SUMO-1 may be involved in tumor aggressiveness even in patients with early stage oral squamous cell carcinoma
17509614 These results suggest that KyoT2 is a substrate of SUMO modification catalyzed by PIAS1, and that SUMOylation may modulate the transcriptional repression effect of KyoT2 on the Notch/RBP-J signaling pathway [Kyot2].
17466333 analysis of SUMO-Ubc9 interaction
17360386 The increased expression of SUMO-1 in rheumatoid arthritis (RA) synovial fibroblasts (SFs) contributes to the resistance of these cells against Fas-induced apoptosis through increased SUMOylation of nuclear PML protein.
17320104 NMR characterization of the energy landscape of SUMO-1.
17164289 sumoylation has a role in keratinocyte differentiation
17060459 TDG sumoylation promotes intramolecular interactions with amino- and carboxy-terminal SUMO-1 binding motifs that dramatically alter the biochemical properties and subcellular localization of TDG
17027752 SUMO-1, PML and ZNF198 colocalize to punctate structures, shown by immunocytochemistry to be PML bodies.
16990542 role for SUMO1 in mammalian development; findings suggest that sumoylation regulates a network of genes that converge in palate development
16904644 Myeloid elf-1-like factor (MEF) or Elf4 is modified by conjugation with SUMO-1/-2 (small ubiquitin-related modifier).
16712526 A study evalution the mechanisms of regulation of the sumoylation pathway by the SUMO-specific proteases is presented.
16651613 SUMOylation and activation of ataxia-telangiectasia-mutated protein, PKCdelta, caspase-3, and nuclear factor kappaB signaling pathways modulate salivary adaptive responses to stress in cells exposed to either 1% O(2) or DFO.
16631117 It shows that Ubc9 interacts with SOX4 and represses its transcriptional activity independent of its SUMO-1-conjugating activity.
16568089 SUMO-1 Sam68 fusion protein, on the other hand, inhibited the ability of Sam68 to induce apoptosis but was a strong repressor of cyclin D1 expression
16563226 MEF2A undergoes sumoylation primarily at a single lysine residue (K395) both in vitro and in vivo.Our results suggest that protein sumoylation could play a pivotal role in controlling MEF2 transcriptional activity.
16524884 Using yeast two-hybrid system, bioinformatics, and NMR spectroscopy we define a common SUMO-interacting motif (SIM) and map its binding surfaces on SUMO1 and SUMO2
16501610 PML stimulated hSUMO-1 modification in yeast, in a manner that was dependent upon PML's RING-finger domain. PML:RARalpha also stimulated hSUMO-1 conjugation in yeast.
16478998 association of SUMO modification of XRCC4 with the control of the repair and recombination associated with DNA breaks
16475184 SUMO has a biological role in enhancing the cytoplasmonuclear transport of its target protein Daxx
16464864 SUMO1 is involved in a modification of tau and alpha-synuclein that may also have implications for their pathogenic roles in neurodegenerative diseases
16460827 findings show that Epstein-Barr virus Rta interacts and colocalizes with PIASxalpha and PIASxbeta in the nucleus; these interactions seem to enhance Rta sumoylation
16428803 SUMO1 polymeric chain assembles on human topoisomerase I in vitro
16421094 SUMO-1 controls the protein stability and the biological function of phosducin.
16415059 NMR characterization of the urea-denatured state of SUMO-1
16352666 Data suggest that testicular SUMO-1 has specific functions in heterochromatin organization, meiotic centromere function, and gene expression.
16204249 the SUMO binding motif forms an extended structure that binds between the alpha-helix and a beta-strand of SUMO-1
16154161 our findings place SUMOylation target on the centrosome structure protein, hNinein, which results in the switch localization from centrosome to nucleus
16125395 presence of SUMO1 in non-pathological conditions, in a large promyelocytic leukemia-nuclear inclusion bodies in human supraoptic neurons
16122737 Data show that Topors enhances the conjugation of the small ubiquitin-like modifier 1 (SUMO-1) to p53 in vivo and in a reconstituted in vitro system.
16120648 these data suggest a novel role for sumoylation in regulating RNA-editing activity.
16117725 The interaction of SUMO1 and ubiquitin pathways of post-translational protein modification are reported, including their localization and conjugation status during proteasome inhibition.
16112644 SUMO-1 modification of proteins appears to have an important role in EBV lytic replication
16055710 c-Fos/c-Jun AP-1 dimer activity is downregulated by SUMO-1, SUMO-2, and SUMO-3
15958389 HIPK2 effector function on JNK is modulated through dynamic SUMO-1 modification
15931224 Nup358/RanBP2 acts as an E3 by binding both SUMO and Ubc9 to position the SUMO-E2-thioester in an optimal orientation to enhance conjugation
15923626 Data show that sumoylated LRH-1 is exclusively localized in promyelocytic leukemia protein nuclear bodies, and that this association is a dynamic process regulated in part by SUMO-1.
15907800 sumoylation-deficient MDMX mutant undergoes normal ubiquitination and degradation by MDM2, normal nuclear translocation and degradation after DNA damage, and inhibits p53 with wild type efficiency
15882793 In cell culture experiments, we found that the nuclear and perinuclear accumulation of SUMO-1 aggregates could be induced in glioma cells by chemical inhibition of proteasomal protein degradation.
15881673 OZF interacts with UBC9, the E2 enzyme involved in the covalent conjugation of the small ubiquitin-like modifier 1 (SUMO-1). Conjugation of SUMO-1 to a Kruppel zinc finger motif.
15857832 ERM is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity
15823533 SUMO1 conjugation to the C-terminal K330 of thymine DNA glycosylase modulates the DNA binding function of the N terminus to induce dissociation of the glycosylase from the AP site while it leaves the catalytic properties of the enzyme unaffected.
15788563 SUMO1 represses transcriptional activity of SOX3.
15660128 structures of heterodimeric Sae1/Sae2-Mg.ATP and Sae1/Sae2-SUMO-1-Mg.ATP complexes
15637059 reversible SUMO modification at hsTAF5 contributes to the dynamic regulation of TFIID promoter-binding activity in human cells
15613319 SUMOylation of HIV-1 IN at positions K46, K136, and K244 by SUMO involves HIV-1 infectivity
15507114 sumoylation is involved in negative regulation of the transactivating function of PPARgamma2
15456902 SUMO-1 shows patterns of utilization that are clearly discrete from the patterns of SUMO-2 and -3 throughout the cell cycle
15355965 the RanGAP1 consensus sumoylation site and SUMO-1 C terminus are both conformationally flexible
15337742 GATA4 is a SUMO-1-targeted transcription factor and together with PIAS1 is a potent regulator of cardiac gene activity
15272016 CENPC target sites that can be sumoylated by SUMO-2 were shown to be equally susceptible to SUMO-1 attachments which include specific sites on SUMO-2 itself, Ubc9, and the recombinant CENP-C fragments.
15229220 SUMO-1 conjugation at the Lys-19 residue is crucial for enhancing the transactivation activity of EBV Rta
15220454 SUMO modification of Human Cytomegalovirus (HCMV) IE1-72 kDa contributes to efficient HCMV replication by promoting the accumulation of IE2-86 kDa.
15123625 These results suggest that the PPARgamma-dependent transactivation pathway seems to be modulated by SUMO-1 modification and may serve as a novel target for apoptosis-induction therapy in cancer cells.
15037602 In interphase, a significant fraction of vertebrate SUMO1-modified RanGAP1 forms a stable complex with the nucleoporin RanBP2/Nup358 at nuclear pore complexes.
15016812 Regulates protein function by binding to diverse proteins within the cell.
14992729 SUMO-1 promotes histone deacetylase-mediated transcriptional repression.
14752048 Dnmt3a interacts with multiple components of the sumoylation machinery, all of which are involved in conjugating the small ubiquitin-like modifier polypeptide, SUMO-1, to its target proteins
14637113 recruitment of SUMO-1 modified proteins into insoluble nuclear inclusions and proteasomal dysfunction may be involved in the pathogenesis neuronal intranuclear inclusion disease
14563852 SENP1 localization is influenced by expression and localization of SUMO-1-conjugated target proteins within the cell.
14527952 PLZF colocalizes with SUMO-1 in the nucleus; lysine 242 in the RD2 domain of human PLZF was identified as the sumoylation site
14514699 Smad4 is covalently modified by SUMO-1 and facilitates Smad-dependent transcriptional activation
14500761 PIAS1 conjugates SUMO-1 to human mineralocorticoid receptor.
12855578 PIAS1 was found to strongly stimulate sumoylation of STAT1 at Lys703 by SUMO-1 conjugation to STAT1; results suggest a negative regulatory function for sumoylation.
12788062 SRF is modified by SUMO-1 chiefly at lysine(147) within the DNA-binding domain.
12665592 HSF1 is modified by SUMO-1 and SUMO-2 in a stress-inducible manner.
12646186 examination of the role of the phosphorylation event in regulating SUMO-1 modification of HSF1
12552083 SUMO-1 has a role in modifying cAMP-response element-binding protein (CREB) in prolonged hypoxia
12529333 Overexpression of SUMO-1 enhanced PR-mediated gene transcription even in the presence of non-sumoylated mutants of SRC-1.
12511558 SUMO1 has a role in PIASy-enhanced modification of C-EPB alpha
12354770 role in modifying aryl hydrocarbon receptor nuclear transporter at Lys245
12297306 p14ARF promotes accumulation of (H)Mdm2 conjugated to the small ubiquitin-like protein SUMO-1.
12200128 binding of proteins SALL1, UBE2I and SUMO-1
12144530 post-translationally modifies glucocorticoid receptor in a ligand-enhanced fashion
12060666 role in modulating nuclear receptor interaction domain of GRIP1

AA Sequence

MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQR      1 - 70
IADNHTPKELGMEEEDVIEVYQEQTGGHSTV                                            71 - 101
//

Text Mined References (355)

PMID Year Title
26578773 2015 PML IV/ARF interaction enhances p53 SUMO-1 conjugation, activation, and senescence.
26563097 Roles for SUMO in pre-mRNA processing.
26549688 2016 Transcription regulation of nuclear receptor PXR: Role of SUMO-1 modification and NDSM in receptor function.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26449956 2016 SUMO1 depletion prevents lipid droplet accumulation and HCV replication.
26403314 2016 Systematically identify key genes in inflammatory and non-inflammatory breast cancer.
26400283 2015 DAP1 high expression increases risk of lymph node metastases in squamous cell carcinoma of the oral cavity.
26244656 2015 The Nucleus-Localized Epidermal Growth Factor Receptor Is SUMOylated.
26223657 2015 Small Ubiquitin-like Modifier Alters IFN Response.
26212320 2015 A Critical SUMO1 Modification of LKB1 Regulates AMPK Activity during Energy Stress.
26060329 2015 SUMO deconjugation is required for arsenic-triggered ubiquitylation of PML.
25880753 2015 TRIM5? is a SUMO substrate.
25867063 2016 SUMO modification of Akt regulates global SUMOylation and substrate SUMOylation specificity through Akt phosphorylation of Ubc9 and SUMO1.
25800734 2015 The chromatin scaffold protein SAFB1 localizes SUMO-1 to the promoters of ribosomal protein genes to facilitate transcription initiation and splicing.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25497731 2015 Structural and functional characterization of the phosphorylation-dependent interaction between PML and SUMO1.
25484073 2015 SUMO1 promotes A? production via the modulation of autophagy.
25416956 2014 A proteome-scale map of the human interactome network.
25391294 2015 Sumoylation of p35 modulates p35/cyclin-dependent kinase (Cdk) 5 complex activity.
25378699 2014 SUMOylation at K340 inhibits tau degradation through deregulating its phosphorylation and ubiquitination.
25241153 2014 Study of MDM2 and SUMO-1 expression in actinic cheilitis and lip cancer.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25183729 2014 DAP1, a negative regulator of autophagy, controls SubAB-mediated apoptosis and autophagy.
25118297 2014 SUMO1 in human sperm: new targets, role in motility and morphology and relationship with DNA damage.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25111678 2014 SUMO1 genetic polymorphisms may contribute to the risk of nonsyndromic cleft lip with or without palate: a meta-analysis.
25074923 2014 Activation of the double-stranded RNA-dependent protein kinase PKR by small ubiquitin-like modifier (SUMO).
24953629 2014 SUMO1 modification stabilizes CDK6 protein and drives the cell cycle and glioblastoma progression.
24942926 2014 Interferon controls SUMO availability via the Lin28 and let-7 axis to impede virus replication.
24819975 2014 Small ubiquitin-related modifier-1 modification regulates all-trans-retinoic acid-induced differentiation via stabilization of retinoic acid receptor ?.
24753249 2014 E2-mediated small ubiquitin-like modifier (SUMO) modification of thymine DNA glycosylase is efficient but not selective for the enzyme-product complex.
24656128 2014 SUMO chain-induced dimerization activates RNF4.
24651376 2014 Characterization of nuclear localization and SUMOylation of the ATBF1 transcription factor in epithelial cells.
24434214 2014 Cbx4 governs HIF-1? to potentiate angiogenesis of hepatocellular carcinoma by its SUMO E3 ligase activity.
24344134 2014 PIASx? ligase enhances SUMO1 modification of PTEN protein as a SUMO E3 ligase.
24309115 2014 Cell cycle-dependent SUMO-1 conjugation to nuclear mitotic apparatus protein (NuMA).
24286314 2014 Characterization of a novel posttranslational modification in polypyrimidine tract-binding proteins by SUMO1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24174529 2013 Identification of a non-covalent ternary complex formed by PIAS1, SUMO1, and UBC9 proteins involved in transcriptional regulation.
24072711 2013 The SUMO1-E67 interacting loop peptide is an allosteric inhibitor of the dipeptidyl peptidases 8 and 9.
23996296 2013 Up-regulation of SUMO1 pseudogene 3 (SUMO1P3) in gastric cancer and its clinical association.
23407422 2013 Small ubiquitin-related modifier (SUMO) pathway-mediated enhancement of human cytomegalovirus replication correlates with a recruitment of SUMO-1/3 proteins to viral replication compartments.
23395904 2013 Ubc9 acetylation modulates distinct SUMO target modification and hypoxia response.
23382880 2013 SUMO-1 modification on K166 of polyQ-expanded ataxin-3 strengthens its stability and increases its cytotoxicity.
23369348 2013 Role of SUMO-1 and SUMO interacting motifs in rhesus TRIM5?-mediated restriction.
23350884 2013 Evaluation of the expression of p53, MDM2, and SUMO-1 in oral lichen planus.
23243001 2013 Lamin A tail modification by SUMO1 is disrupted by familial partial lipodystrophy-causing mutations.
23229893 2013 SUMO-1 is associated with a subset of lysosomes in glial protein aggregate diseases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160374 2013 CLOCK is a substrate of SUMO and sumoylation of CLOCK upregulates the transcriptional activity of estrogen receptor-?.
23152501 2012 A novel SUMO1-specific interacting motif in dipeptidyl peptidase 9 (DPP9) that is important for enzymatic regulation.
23092970 2012 SUMOylation of hnRNP-K is required for p53-mediated cell-cycle arrest in response to DNA damage.
23086935 2012 Poly-small ubiquitin-like modifier (PolySUMO)-binding proteins identified through a string search.
23078246 2013 Small ubiquitin-like modifier 1-3 conjugation [corrected] is activated in human astrocytic brain tumors and is required for glioblastoma cell survival.
23077236 2013 Localization and identification of sumoylated proteins in human sperm: excessive sumoylation is a marker of defective spermatozoa.
22975420 2013 SUMO1 modulates A? generation via BACE1 accumulation.
22905217 2012 SUMO modification of Stra13 is required for repression of cyclin D1 expression and cellular growth arrest.
22878415 2012 Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions.
22748127 2012 Lens epithelium-derived growth factor deSumoylation by Sumo-specific protease-1 regulates its transcriptional activation of small heat shock protein and the cellular response.
22731716 2012 SUMOylation of claudin-2.
22713753 2012 SUMO1 modification of PTEN regulates tumorigenesis by controlling its association with the plasma membrane.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22651256 2012 Regulation of small ubiquitin-like modifier-1, nuclear receptor coreceptor, histone deacetylase 3, and peroxisome proliferator-activated receptor-? in human adipose tissue.
22612509 2012 Ubiquitin-related proteins in neuronal and glial intranuclear inclusions in intranuclear inclusion body disease.
22586270 2012 Identification of estrogen receptor ? as a SUMO-1 target reveals a novel phosphorylated sumoylation motif and regulation by glycogen synthase kinase 3?.
22555612 2012 SUMOylation of Blimp-1 is critical for plasma cell differentiation.
22406621 2012 The SUMO E3-ligase PIAS1 regulates the tumor suppressor PML and its oncogenic counterpart PML-RARA.
22403398 2012 Small ubiquitin-like modifier (SUMO) modification of E1 Cys domain inhibits E1 Cys domain enzymatic activity.
22398289 2012 SUMO binding by the Epstein-Barr virus protein kinase BGLF4 is crucial for BGLF4 function.
22227369 2012 A non-covalent interaction between small ubiquitin-like modifier-1 and Zac1 regulates Zac1 cellular functions.
22194619 2012 Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
22164242 2011 Crosstalk between JNK and SUMO signaling pathways: deSUMOylation is protective against H2O2-induced cell injury.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21983723 2011 [The effect of small ubiquitin-like modifier-1 modification on the formation of Lewy body-like inclusions in cytoplasm and apoptosis of HEK293 cell induced by overexpression and mutation of alpha-synuclein].
21968017 2011 Ribosomal protein S3 is stabilized by sumoylation.
21965678 2011 SUMOylation and SUMO-interacting motif (SIM) of metastasis tumor antigen 1 (MTA1) synergistically regulate its transcriptional repressor function.
21957283 2011 Regulation of vaccinia virus E3 protein by small ubiquitin-like modifier proteins.
21931855 2011 Complex SUMO-1 regulation of cardiac transcription factor Nkx2-5.
21900893 2011 SUMO1-dependent modulation of SERCA2a in heart failure.
21880768 2011 Human cytomegalovirus infection causes degradation of Sp100 proteins that suppress viral gene expression.
21878624 2011 Swapping small ubiquitin-like modifier (SUMO) isoform specificity of SUMO proteases SENP6 and SENP7.
21829689 2011 SUMOylation of DEC1 protein regulates its transcriptional activity and enhances its stability.
21811235 2011 LUBAC regulates NF-?B activation upon genotoxic stress by promoting linear ubiquitination of NEMO.
21722636 2011 SUMOylation of Blimp-1 promotes its proteasomal degradation.
21683690 2011 SUMO1 attenuates stress-induced ROS generation by inhibiting NADPH oxidase 2.
21641618 2011 Proteasome inhibition induces ?-synuclein SUMOylation and aggregate formation.
21563299 2011 Defective sumoylation pathway directs congenital heart disease.
21545853 2011 Characterization of a novel posttranslational modification in neuronal nitric oxide synthase by small ubiquitin-related modifier-1.
21527745 2011 SUMO1 negatively regulates reactive oxygen species production from NADPH oxidases.
21490953 2011 SUMO-interacting motifs of human TRIM5? are important for antiviral activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21336309 2011 Oncogenic Ras abrogates MEK SUMOylation that suppresses the ERK pathway and cell transformation.
21284855 2011 SUMO-1 regulates the conformational dynamics of thymine-DNA Glycosylase regulatory domain and competes with its DNA binding activity.
21269460 2011 Initial characterization of the human central proteome.
21268066 2011 SUMOylation of DLX3 by SUMO1 promotes its transcriptional activity.
21242980 2011 Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation.
21212807 2011 Inducible SUMO modification of TANK alleviates its repression of TLR7 signalling.
21192925 2011 Role of the SUMO-interacting motif in HIPK2 targeting to the PML nuclear bodies and regulation of p53.
21189065 2011 Interactions between small ubiquitin-like modifier 1 and nonsyndromic orofacial clefts.
21123177 2011 Small ubiquitin-related modifier (SUMO)-1 promotes glycolysis in hypoxia.
21057547 2011 AXIN is an essential co-activator for the promyelocytic leukemia protein in p53 activation.
21047957 2011 Modification of nonstructural protein 1 of influenza A virus by SUMO1.
21044801 2011 SUMO1 as a candidate gene for non-syndromic cleft lip with or without cleft palate: no evidence for the involvement of common or rare variants in Central European patients.
21039605 2011 Sumo1-ylation of human spermatozoa and its relationship with semen quality.
20932933 2011 Small ubiquitin-related modifier-1: Wrestling with protein regulation.
20881090 2011 Covalent modification by SUMO is required for efficient disruption of PML oncogenic domains by Kaposi's sarcoma-associated herpesvirus latent protein LANA2.
20802522 2011 A functional SUMO-interacting motif in the transactivation domain of c-Myb regulates its myeloid transforming ability.
20738159 2010 Association between polymorphisms at small ubiquitin-like modifier 1 and nonsyndromic orofacial clefts in Western China.
20711444 2010 SUMOylation by Pias1 regulates the activity of the Hedgehog dependent Gli transcription factors.
20661221 2010 PIASy stimulates HIF1? SUMOylation and negatively regulates HIF1? activity in response to hypoxia.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20584900 2010 A small ubiquitin-related modifier-interacting motif functions as the transcriptional activation domain of Krüppel-like factor 4.
20544801 2010 Association between genetic variants of reported candidate genes or regions and risk of cleft lip with or without cleft palate in the polish population.
20533263 2010 [Effect of SUMO-1 on mitochondria subcellular localization of alpha-synuclein and its degradation via ubiquitin-proteasome system].
20519406 2010 Role of noncovalent SUMO binding by the human cytomegalovirus IE2 transactivator in lytic growth.
20501649 2010 Role of the Zn(2+) motif of E1 in SUMO adenylation.
20388717 2010 In vivo identification of sumoylation sites by a signature tag and cysteine-targeted affinity purification.
20224576 2010 Sumoylation of eIF4E activates mRNA translation.
20145208 2010 SUMOylation mediates the nuclear translocation and signaling of the IGF-1 receptor.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19955185 2010 SUMOylation of human peroxisome proliferator-activated receptor alpha inhibits its trans-activity through the recruitment of the nuclear corepressor NCoR.
19937600 2010 Testing reported associations of genetic risk factors for oral clefts in a large Irish study population.
19917317 2010 Identification of the non-structural influenza A viral protein NS1A as a bona fide target of the Small Ubiquitin-like MOdifier by the use of dicistronic expression constructs.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19889771 2010 Modification of small hepatitis delta virus antigen by SUMO protein.
19859084 2010 Association of SUMO1 and UBC9 genotypes with tumor response in non-small-cell lung cancer treated with irinotecan-based chemotherapy.
19779455 2009 PARP-1 transcriptional activity is regulated by sumoylation upon heat shock.
19680224 2009 SENP3 is responsible for HIF-1 transactivation under mild oxidative stress via p300 de-SUMOylation.
19596686 2009 Proteomics analysis of nucleolar SUMO-1 target proteins upon proteasome inhibition.
19565496 2009 Small ubiquitin-like modifier 1 [corrected] mediates the resistance of prosthesis-loosening fibroblast-like synoviocytes against Fas-induced apoptosis.
19497852 2009 Small ubiquitin-like modifier (SUMO) modification of the androgen receptor attenuates polyglutamine-mediated aggregation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19384898 2009 Over-expression of SUMO-1 induces the up-regulation of heterogeneous nuclear ribonucleoprotein A2/B1 isoform B1 (hnRNP A2/B1 isoform B1) and uracil DNA glycosylase (UDG) in hepG2 cells.
19380586 2009 Role of SUMO in RNF4-mediated promyelocytic leukemia protein (PML) degradation: sumoylation of PML and phospho-switch control of its SUMO binding domain dissected in living cells.
19297320 2009 Adenosine signaling mediates SUMO-1 modification of IkappaBalpha during hypoxia and reoxygenation.
19287951 2009 A novel mechanism whereby BRCA1/1a/1b fine tunes the dynamic complex interplay between SUMO-dependent/independent activities of Ubc9 on E2-induced ERalpha activation/repression and degradation in breast cancer cells.
19251700 2009 SUMO modification regulates the transcriptional repressor function of aryl hydrocarbon receptor repressor.
19223394 2009 SUMOylation regulates Kv2.1 and modulates pancreatic beta-cell excitability.
19041634 2009 SUMOylation of RORalpha potentiates transcriptional activation function.
19029252 2009 The CTCF insulator protein is posttranslationally modified by SUMO.
18983974 2008 SUMO1 polymorphisms are associated with non-syndromic cleft lip with or without cleft palate.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18836734 2008 NSF, Unc-18-1, dynamin-1 and HSP90 are inclusion body components in neuronal intranuclear inclusion disease identified by anti-SUMO-1-immunocapture.
18762900 2008 DNA methyltransferase 3B mutant in ICF syndrome interacts non-covalently with SUMO-1.
18707152 2008 Phosphorylation of SUMO-1 occurs in vivo and is conserved through evolution.
18694876 2008 Small ubiquitin-related modifier (SUMO)-1, SUMO-2/3 and SUMOylation are involved with centromeric heterochromatin of chromosomes 9 and 1 and proteins of the synaptonemal complex during meiosis in men.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18617892 2008 SUMO1 modification of NF-kappaB2/p100 is essential for stimuli-induced p100 phosphorylation and processing.
18592385 2008 In human pachytene spermatocytes, SUMO protein is restricted to the constitutive heterochromatin.
18579533 2008 Regulation of cardiac specific nkx2.5 gene activity by small ubiquitin-like modifier.
18538659 2008 Mechanism and consequences for paralog-specific sumoylation of ubiquitin-specific protease 25.
18408734 2008 RNF4 is a poly-SUMO-specific E3 ubiquitin ligase required for arsenic-induced PML degradation.
18408014 2008 SUMO conjugation to the matrix attachment region-binding protein, special AT-rich sequence-binding protein-1 (SATB1), targets SATB1 to promyelocytic nuclear bodies where it undergoes caspase cleavage.
18404132 2008 SUMO1 enhances 17-beta estradiol's effect on CRH promoter activation through estrogen receptors.
18211901 2008 SUMOylation modulates the transcription repressor function of RIP140.
18093978 2008 Nuclear tumor necrosis factor receptor-associated factor 6 in lymphoid cells negatively regulates c-Myb-mediated transactivation through small ubiquitin-related modifier-1 modification.
18063693 2008 Phosphorylation-dependent sumoylation regulates estrogen-related receptor-alpha and -gamma transcriptional activity through a synergy control motif.
17976381 2007 The E3 ligase Topors induces the accumulation of polysumoylated forms of DNA topoisomerase I in vitro and in vivo.
17956732 2007 RSUME, a small RWD-containing protein, enhances SUMO conjugation and stabilizes HIF-1alpha during hypoxia.
17932034 2007 Induction of the SUMO-specific protease 1 transcription by the androgen receptor in prostate cancer cells.
17696781 2007 Sumoylation of the zinc finger protein ZXDC enhances the function of its transcriptional activation domain.
17671677 2007 Overexpression of small ubiquitin-related modifier-1 and sumoylated Mdm2 in oral squamous cell carcinoma: possible involvement in tumor proliferation and prognosis.
17509614 2007 The transcriptional repression activity of KyoT2 on the Notch/RBP-J pathway is regulated by PIAS1-catalyzed SUMOylation.
17491593 2007 Noncovalent interaction between Ubc9 and SUMO promotes SUMO chain formation.
17466333 2007 Structure and analysis of a complex between SUMO and Ubc9 illustrates features of a conserved E2-Ubl interaction.
17360386 2007 Modification of nuclear PML protein by SUMO-1 regulates Fas-induced apoptosis in rheumatoid arthritis synovial fibroblasts.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17320104 2007 NMR characterization of the energy landscape of SUMO-1 in the native-state ensemble.
17164289 2007 Sumoylation dynamics during keratinocyte differentiation.
17099698 2006 SUMO protease SENP1 induces isomerization of the scissile peptide bond.
17081985 2006 The mechanisms of PML-nuclear body formation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17066076 2006 Regulation of MBD1-mediated transcriptional repression by SUMO and PIAS proteins.
17060459 2007 SUMO-1-dependent allosteric regulation of thymine DNA glycosylase alters subnuclear localization and CBP/p300 recruitment.
17036045 2006 An extended consensus motif enhances the specificity of substrate modification by SUMO.
17027752 2006 ZNF198, a zinc finger protein rearranged in myeloproliferative disease, localizes to the PML nuclear bodies and interacts with SUMO-1 and PML.
17000644 2006 Distinct and overlapping sets of SUMO-1 and SUMO-2 target proteins revealed by quantitative proteomics.
16990542 2006 SUMO1 haploinsufficiency leads to cleft lip and palate.
16955485 2006 Functional modulation of parkin through physical interaction with SUMO-1.
16904644 2006 SUMO down-regulates the activity of Elf4/myeloid Elf-1-like factor.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16712526 2006 Crystal structure of the SENP1 mutant C603S-SUMO complex reveals the hydrolytic mechanism of SUMO-specific protease.
16690127 2007 Differential regulation of interleukin-1 receptor associated kinase 1 (IRAK1) splice variants.
16678795 2006 Modification of Msx1 by SUMO-1.
16651613 2006 SUMOylation attenuates sensitivity toward hypoxia- or desferroxamine-induced injury by modulating adaptive responses in salivary epithelial cells.
16631117 2006 Ubc9 interacts with SOX4 and represses its transcriptional activity.
16600910 2006 PIAS1 confers DNA-binding specificity on the Msx1 homeoprotein.
16568089 2006 SUMO modification of Sam68 enhances its ability to repress cyclin D1 expression and inhibits its ability to induce apoptosis.
16563226 SUMO-1 modification of MEF2A regulates its transcriptional activity.
16524884 2006 Specification of SUMO1- and SUMO2-interacting motifs.
16501610 2006 The promyelocytic leukemia protein stimulates SUMO conjugation in yeast.
16494873 2006 Sumoylation of the SOX10 transcription factor regulates its transcriptional activity.
16484498 2006 A calcium-regulated MEF2 sumoylation switch controls postsynaptic differentiation.
16478998 2006 SUMO modification of human XRCC4 regulates its localization and function in DNA double-strand break repair.
16478538 2006 Phosphorylation-facilitated sumoylation of MEF2C negatively regulates its transcriptional activity.
16475184 2006 SUMO regulates the cytoplasmonuclear transport of its target protein Daxx.
16464864 2006 Small ubiquitin-like modifier (SUMO) modification of natively unfolded proteins tau and alpha-synuclein.
16460827 2006 Sumoylation of Rta of Epstein-Barr virus is preferentially enhanced by PIASxbeta.
16443219 2006 Nuclear localisation of endogenous SUMO-1-modified PDGF-C in human thyroid tissue and cell lines.
16442531 2006 Repression of SOX6 transcriptional activity by SUMO modification.
16428860 2005 Phosphorylation of RanGAP1 stabilizes its interaction with Ran and RanBP1.
16428803 2006 Assembly of a polymeric chain of SUMO1 on human topoisomerase I in vitro.
16428449 2006 Inhibition of DNA binding by differential sumoylation of heat shock factors.
16421094 2006 SUMO-1 controls the protein stability and the biological function of phosducin.
16415059 2006 Local structural preferences and dynamics restrictions in the urea-denatured state of SUMO-1: NMR characterization.
16352666 2006 SUMO-1, human male germ cell development, and the androgen receptor in the testis of men with normal and abnormal spermatogenesis.
16204249 2005 Small ubiquitin-like modifier (SUMO) recognition of a SUMO binding motif: a reversal of the bound orientation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16154161 2006 SUMO-1 modification of centrosomal protein hNinein promotes hNinein nuclear localization.
16125395 2006 The PML-nuclear inclusion of human supraoptic neurons: a new compartment with SUMO-1- and ubiquitin-proteasome-associated domains.
16122737 2005 Topors acts as a SUMO-1 E3 ligase for p53 in vitro and in vivo.
16120648 2005 SUMO-1 modification alters ADAR1 editing activity.
16117725 2005 Comparison of the SUMO1 and ubiquitin conjugation pathways during the inhibition of proteasome activity with evidence of SUMO1 recycling.
16112644 2005 Effects of SUMO-1 upon Epstein-Barr virus BZLF1 function and BMRF1 expression.
16055710 2005 Down-regulation of c-Fos/c-Jun AP-1 dimer activity by sumoylation.
15983381 2005 Interaction of DJ-1 with Daxx inhibits apoptosis signal-regulating kinase 1 activity and cell death.
15959518 2005 Crystal structure of thymine DNA glycosylase conjugated to SUMO-1.
15958389 2005 Regulation of homeodomain-interacting protein kinase 2 (HIPK2) effector function through dynamic small ubiquitin-related modifier-1 (SUMO-1) modification.
15931224 2005 Insights into E3 ligase activity revealed by a SUMO-RanGAP1-Ubc9-Nup358 complex.
15923626 2005 SUMO-dependent compartmentalization in promyelocytic leukemia protein nuclear bodies prevents the access of LRH-1 to chromatin.
15907800 2005 Modification of MDMX by sumoylation.
15896780 2005 Differential interactions of the homeodomain-interacting protein kinase 2 (HIPK2) by phosphorylation-dependent sumoylation.
15882793 2005 SUMO-1 marks subdomains within glial cytoplasmic inclusions of multiple system atrophy.
15881673 2005 A Kruppel zinc finger of ZNF 146 interacts with the SUMO-1 conjugating enzyme UBC9 and is sumoylated in vivo.
15857832 2005 SUMO modification of the Ets-related transcription factor ERM inhibits its transcriptional activity.
15848177 2005 Sumoylation of the nucleocapsid protein of severe acute respiratory syndrome coronavirus.
15823533 2005 Functionality of human thymine DNA glycosylase requires SUMO-regulated changes in protein conformation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15788563 2005 SUMO represses transcriptional activity of the Drosophila SoxNeuro and human Sox3 central nervous system-specific transcription factors.
15782135 2005 Caspase-8 sumoylation is associated with nuclear localization.
15723079 2005 SUMO modification of the ubiquitin-conjugating enzyme E2-25K.
15660128 2005 Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1.
15637059 2005 SUMO-1 modification of human transcription factor (TF) IID complex subunits: inhibition of TFIID promoter-binding activity through SUMO-1 modification of hsTAF5.
15608651 2005 Unique binding interactions among Ubc9, SUMO and RanBP2 reveal a mechanism for SUMO paralog selection.
15572661 2004 Negative modulation of androgen receptor transcriptional activity by Daxx.
15507114 2004 The transactivating function of peroxisome proliferator-activated receptor gamma is negatively regulated by SUMO conjugation in the amino-terminal domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15487983 2005 Mapping residues of SUMO precursors essential in differential maturation by SUMO-specific protease, SENP1.
15456902 2004 Distinct in vivo dynamics of vertebrate SUMO paralogues.
15355965 2004 Structural and dynamic independence of isopeptide-linked RanGAP1 and SUMO-1.
15337742 2004 SUMO-1 modification activated GATA4-dependent cardiogenic gene activity.
15296745 2004 A basis for SUMO protease specificity provided by analysis of human Senp2 and a Senp2-SUMO complex.
15272016 2004 In vitro modification of human centromere protein CENP-C fragments by small ubiquitin-like modifier (SUMO) protein: definitive identification of the modification sites by tandem mass spectrometry analysis of the isopeptides.
15229220 2004 Post-translational modification of Rta of Epstein-Barr virus by SUMO-1.
15220454 2004 SUMOylation of the human cytomegalovirus 72-kilodalton IE1 protein facilitates expression of the 86-kilodalton IE2 protein and promotes viral replication.
15123625 2004 Transcriptional activity of peroxisome proliferator-activated receptor gamma is modulated by SUMO-1 modification.
15064418 2004 SUMO modification of Huntingtin and Huntington's disease pathology.
15037602 2004 RanGAP1*SUMO1 is phosphorylated at the onset of mitosis and remains associated with RanBP2 upon NPC disassembly.
15016812 2004 Broad spectrum identification of cellular small ubiquitin-related modifier (SUMO) substrate proteins.
14992729 2004 SUMO promotes HDAC-mediated transcriptional repression.
14752048 2004 Modification of de novo DNA methyltransferase 3a (Dnmt3a) by SUMO-1 modulates its interaction with histone deacetylases (HDACs) and its capacity to repress transcription.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14637113 2003 SUMO-1 marks the nuclear inclusions in familial neuronal intranuclear inclusion disease.
14609633 2003 Association of the nucleocapsid protein of the Seoul and Hantaan hantaviruses with small ubiquitin-like modifier-1-related molecules.
14563852 2004 Characterization of the localization and proteolytic activity of the SUMO-specific protease, SENP1.
14559918 2004 PIASgamma represses the transcriptional activation induced by the nuclear receptor Nurr1.
14527952 2003 Modification of promyelocytic leukemia zinc finger protein (PLZF) by SUMO-1 conjugation regulates its transcriptional repressor activity.
14516784 2003 The DNA topoisomerase I binding protein topors as a novel cellular target for SUMO-1 modification: characterization of domains necessary for subcellular localization and sumolation.
14514699 2003 Transforming growth factor-beta-mediated signaling via the p38 MAP kinase pathway activates Smad-dependent transcription through SUMO-1 modification of Smad4.
14500761 2003 Protein inhibitor of activated signal transducer and activator of transcription 1 interacts with the N-terminal domain of mineralocorticoid receptor and represses its transcriptional activity: implication of small ubiquitin-related modifier 1 modification.
14500712 2003 PIAS1-mediated sumoylation of focal adhesion kinase activates its autophosphorylation.
12924945 2003 Role of an N-terminal site of Ubc9 in SUMO-1, -2, and -3 binding and conjugation.
12855578 2003 PIAS proteins promote SUMO-1 conjugation to STAT1.
12832072 2003 The SUMO pathway is required for selective degradation of DNA topoisomerase IIbeta induced by a catalytic inhibitor ICRF-193(1).
12810706 2003 Modification of CCAAT/enhancer-binding protein-beta by the small ubiquitin-like modifier (SUMO) family members, SUMO-2 and SUMO-3.
12788062 2003 Serum response factor is modulated by the SUMO-1 conjugation system.
12769861 2003 Opposed regulation of corepressor CtBP by SUMOylation and PDZ binding.
12761214 2003 Crystal structure of human DJ-1, a protein associated with early onset Parkinson's disease.
12727872 2003 Sumoylation is involved in beta-catenin-dependent activation of Tcf-4.
12679040 2003 The polycomb protein Pc2 is a SUMO E3.
12665592 2003 Phosphorylation of serine 303 is a prerequisite for the stress-inducible SUMO modification of heat shock factor 1.
12663783 2003 Strain variations in single amino acids of the 86-kilodalton human cytomegalovirus major immediate-early protein (IE2) affect its functional and biochemical properties: implications of dynamic protein conformation.
12646186 2003 Insights into the regulation of heat shock transcription factor 1 SUMO-1 modification.
12633878 2003 A novel protein phosphatase 2C family member (PP2Czeta) is able to associate with ubiquitin conjugating enzyme 9.
12631292 2003 Transactivation properties of c-Myb are critically dependent on two SUMO-1 acceptor sites that are conjugated in a PIASy enhanced manner.
12626745 2003 Small ubiquitin-like modifier conjugation regulates nuclear export of TEL, a putative tumor suppressor.
12621041 2003 Activation of transforming growth factor-beta signaling by SUMO-1 modification of tumor suppressor Smad4/DPC4.
12615929 2003 Sterol regulatory element-binding proteins are negatively regulated through SUMO-1 modification independent of the ubiquitin/26 S proteasome pathway.
12590135 2003 The histone deacetylase 9 gene encodes multiple protein isoforms.
12565818 2003 The homeodomain-interacting kinase PKM (HIPK-2) modifies ND10 through both its kinase domain and a SUMO-1 interaction motif and alters the posttranslational modification of PML.
12552083 2003 Small ubiquitin-related modifier-1 modification mediates resolution of CREB-dependent responses to hypoxia.
12529333 2003 Sumoylation of the progesterone receptor and of the steroid receptor coactivator SRC-1.
12526767 2003 Pathways to Parkinsonism.
12511558 2003 A synergy control motif within the attenuator domain of CCAAT/enhancer-binding protein alpha inhibits transcriptional synergy through its PIASy-enhanced modification by SUMO-1 or SUMO-3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439742 2002 SUMO-1 conjugation to intact DNA topoisomerase I amplifies cleavable complex formation induced by camptothecin.
12419227 2002 SUMO-1 modification represses Sp3 transcriptional activation and modulates its subnuclear localization.
12393906 2002 Sumoylation of Mdm2 by protein inhibitor of activated STAT (PIAS) and RanBP2 enzymes.
12383504 2002 Molecular features of human ubiquitin-like SUMO genes and their encoded proteins.
12354770 2002 The aryl hydrocarbon receptor nuclear transporter is modulated by the SUMO-1 conjugation system.
12297306 2002 P14ARF promotes accumulation of SUMO-1 conjugated (H)Mdm2.
12223491 2002 SUMO-1 modification of the C-terminal KVEKVD of Axin is required for JNK activation but has no effect on Wnt signaling.
12200128 2002 Interaction of the developmental regulator SALL1 with UBE2I and SUMO-1.
12193561 2002 Potentiation of glucocorticoid receptor transcriptional activity by sumoylation.
12177000 2002 PIAS1 and PIASxalpha function as SUMO-E3 ligases toward androgen receptor and repress androgen receptor-dependent transcription.
12161447 2002 Transcriptional activity of CCAAT/enhancer-binding proteins is controlled by a conserved inhibitory domain that is a target for sumoylation.
12150977 2002 Modification of Daxx by small ubiquitin-related modifier-1.
12149243 2002 Sumoylation of topoisomerase I is involved in its partitioning between nucleoli and nucleoplasm and its clearing from nucleoli in response to camptothecin.
12144530 2002 Small ubiquitin-related modifier-1 (SUMO-1) modification of the glucocorticoid receptor.
12072434 2002 Transcription factor AP-2 interacts with the SUMO-conjugating enzyme UBC9 and is sumolated in vivo.
12060666 2002 The nuclear receptor interaction domain of GRIP1 is modulated by covalent attachment of SUMO-1.
12032081 2002 The SUMO E3 ligase RanBP2 promotes modification of the HDAC4 deacetylase.
11997515 2002 Desumoylation activity of Axam, a novel Axin-binding protein, is involved in downregulation of beta-catenin.
11960997 2002 SUMO-1 modification of histone deacetylase 1 (HDAC1) modulates its biological activities.
11948183 2002 Essential role of the 58-kDa microspherule protein in the modulation of Daxx-dependent transcriptional repression as revealed by nucleolar sequestration.
11889051 2002 Modification of the human thymine-DNA glycosylase by ubiquitin-like proteins facilitates enzymatic turnover.
11867732 2002 Members of the PIAS family act as SUMO ligases for c-Jun and p53 and repress p53 activity.
11842245 2002 Topors, a p53 and topoisomerase I binding protein, interacts with the adeno-associated virus (AAV-2) Rep78/68 proteins and enhances AAV-2 gene expression.
11792325 2002 The nucleoporin RanBP2 has SUMO1 E3 ligase activity.
11735126 2001 Dnmt3b, de novo DNA methyltransferase, interacts with SUMO-1 and Ubc9 through its N-terminal region and is subject to modification by SUMO-1.
11731474 2001 PIASy, a nuclear matrix-associated SUMO E3 ligase, represses LEF1 activity by sequestration into nuclear bodies.
11709553 2002 Nucleolar delocalization of human topoisomerase I in response to topotecan correlates with sumoylation of the protein.
11583632 2001 Involvement of PIAS1 in the sumoylation of tumor suppressor p53.
11514557 2001 Regulation of heat shock transcription factor 1 by stress-induced SUMO-1 modification.
11500040 2001 The N-terminal internal region of BLM is required for the formation of dots/rod-like structures which are associated with SUMO-1.
11420669 2001 Functional analysis and intracellular localization of p53 modified by SUMO-1.
11384992 2001 The Mdm-2 amino terminus is required for Mdm2 binding and SUMO-1 conjugation by the E2 SUMO-1 conjugating enzyme Ubc9.
11313457 2001 Common properties of nuclear body protein SP100 and TIF1alpha chromatin factor: role of SUMO modification.
11278381 2001 Sumo-1 modification regulates the DNA binding activity of heat shock transcription factor 2, a promyelocytic leukemia nuclear body associated transcription factor.
11112409 2000 Interaction of Daxx, a Fas binding protein, with sentrin and Ubc9.
11080164 2000 Regulation of p53 activity in nuclear bodies by a specific PML isoform.
11078523 2000 Posttranslational modification of TEL and TEL/AML1 by SUMO-1 and cell-cycle-dependent assembly into nuclear bodies.
10964520 2000 A physical and transcript map based upon refinement of the critical interval for PPH1, a gene for familial primary pulmonary hypertension. The International PPH Consortium.
10961991 2000 Covalent modification of p73alpha by SUMO-1. Two-hybrid screening with p73 identifies novel SUMO-1-interacting proteins and a SUMO-1 interaction motif.
10871618 2000 Bovine papillomavirus E1 protein is sumoylated by the host cell Ubc9 protein.
10862613 2000 SUMO-1 conjugation to human DNA topoisomerase II isozymes.
10799485 2000 A new SUMO-1-specific protease, SUSP1, that is highly expressed in reproductive organs.
10759568 2000 SUMO-1 conjugation to topoisomerase I: A possible repair response to topoisomerase-mediated DNA damage.
10694430 2000 Regulation of microphthalmia-associated transcription factor MITF protein levels by association with the ubiquitin-conjugating enzyme hUBC9.
10655495 2000 The sentrin-conjugating enzyme mUbc9 interacts with GLUT4 and GLUT1 glucose transporters and regulates transporter levels in skeletal muscle cells.
10574707 1999 Cell cycle regulation of PML modification and ND10 composition.
10535925 1999 Covalent modification of the homeodomain-interacting protein kinase 2 (HIPK2) by the ubiquitin-like protein SUMO-1.
10212234 1999 The nuclear dot protein sp100, characterization of domains necessary for dimerization, subcellular localization, and modification by small ubiquitin-like modifiers.
10187798 1999 The ubiquitin-homology protein, DAP-1, associates with tumor necrosis factor receptor (p60) death domain and induces apoptosis.
9891849 1998 Characterization of mouse ubiquitin-like SMT3A and SMT3B cDNAs and gene/pseudogenes.
9885291 1999 SUMO-1 modification of the acute promyelocytic leukaemia protein PML: implications for nuclear localisation.
9756909 1998 Identification of three major sentrinization sites in PML.
9740801 1998 Essential requirement for caspase-8/FLICE in the initiation of the Fas-induced apoptotic cascade.
9734360 1998 SUMO-1 modification of IkappaBalpha inhibits NF-kappaB activation.
9654451 1998 Structure determination of the small ubiquitin-related modifier SUMO-1.
9465300 1998 The ubiquitin-homology gene PIC1: characterization of mouse (Pic1) and human (UBL1) genes and pseudogenes.
9442102 1998 Molecular characterization of the SUMO-1 modification of RanGAP1 and its role in nuclear envelope association.
9412458 1997 Evidence for covalent modification of the nuclear dot-associated proteins PML and Sp100 by PIC1/SUMO-1.
9162015 1997 Preferential modification of nuclear proteins by a novel ubiquitin-like molecule.
9119407 1997 SMT3A, a human homologue of the S. cerevisiae SMT3 gene, maps to chromosome 21qter and defines a novel gene family.
9019411 1997 A small ubiquitin-related polypeptide involved in targeting RanGAP1 to nuclear pore complex protein RanBP2.
8978815 1996 A novel ubiquitin-like modification modulates the partitioning of the Ran-GTPase-activating protein RanGAP1 between the cytosol and the nuclear pore complex.
8921390 1996 Associations of UBE2I with RAD52, UBL1, p53, and RAD51 proteins in a yeast two-hybrid system.
8906799 1996 Protection against Fas/APO-1- and tumor necrosis factor-mediated cell death by a novel protein, sentrin.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8812453 1996 UBL1, a human ubiquitin-like protein associating with human RAD51/RAD52 proteins.
8806687 1996 PIC 1, a novel ubiquitin-like protein which interacts with the PML component of a multiprotein complex that is disrupted in acute promyelocytic leukaemia.