Property Summary

NCBI Gene PubMed Count 370
PubMed Score 482.69
PubTator Score 466.23

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 1.6e-03

 OMIM Phenotype (1)

Gene RIF (218)

AA Sequence

IADNHTPKELGMEEEDVIEVYQEQTGGHSTV                                            71 - 101

Text Mined References (387)

PMID Year Title