Property Summary

NCBI Gene PubMed Count 26
PubMed Score 70.35
PubTator Score 30.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.900 2.4e-03
posterior fossa group A ependymoma -4.100 1.6e-19
oligodendroglioma -2.400 1.1e-02
glioblastoma -4.400 9.3e-09
medulloblastoma -2.600 4.3e-09
atypical teratoid / rhabdoid tumor -3.800 1.5e-13
medulloblastoma, large-cell -2.900 2.3e-06
primitive neuroectodermal tumor -2.800 3.5e-05
pediatric high grade glioma -3.600 8.4e-09
pilocytic astrocytoma -3.500 2.1e-11
subependymal giant cell astrocytoma -1.627 3.7e-02
lung carcinoma 1.200 2.6e-25
Pick disease -1.100 3.8e-03

Synonym

Accession Q9BR01 B2R7N3 O43728 ST4A1
Symbols NST
BRSTL1
SULTX3
BR-STL-1
DJ388M5.3
hBR-STL-1

Gene

PANTHER Protein Class (1)

PDB

1ZD1  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

PMID Text
25340730 Across three psychiatric disorders (n=2815 patients), we observed no consistent association between SULT4A1-1 status and atypical antipsychotic effect
24988429 These results show that SULT4A1 is widely expressed in human tissues, but mostly as a splice variant that produces a rapidly degraded protein. Dimerization protects the protein from degradation.
24956247 This study provides a second replication of superior olanzapine response in SULT4A1-1-positive subjects compared with SULT4A1-1-negative subjects.
21521020 determination of SULT4A1-1 haplotype status might be useful for identifying patients who show an enhanced response to long-term olanzapine treatment.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19439498 Cytosolic SULT4A1 interacts with PIN1.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19125109 The lack of polymorphisms in the coding region of the SULT4A1 gene is highly unusual and, along with its high conservation between species, suggests that SULT4A1 may have an important function in vivo.
19125109 Observational study of gene-disease association. (HuGE Navigator)
18823757 These results provide the first evidence of how genetic variation in Sult4A1 may be related to clinical symptoms and cognitive function in schizophrenia
18823757 Observational study of gene-disease association. (HuGE Navigator)
16152568 Candidate gene for schizophrenia susceptibility.
14623933 the first immunohistochemical localization of SULT4A1 in human brain

AA Sequence

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQ      1 - 70
GADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVV     71 - 140
SYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQL    141 - 210
ARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTF    211 - 280
DFYL                                                                      281 - 284
//

Text Mined References (27)

PMID Year Title
25340730 2014 SULT4A1 haplotype: conflicting results on its role as a biomarker of antipsychotic response.
24988429 2014 Expression of the orphan cytosolic sulfotransferase SULT4A1 and its major splice variant in human tissues and cells: dimerization, degradation and polyubiquitination.
24956247 2014 Replication of SULT4A1-1 as a pharmacogenetic marker of olanzapine response and evidence of lower weight gain in the high response group.
23386860 2013 Exploring genome-wide - dietary heme iron intake interactions and the risk of type 2 diabetes.
21521020 2011 Evidence for a SULT4A1 haplotype correlating with baseline psychopathology and atypical antipsychotic response.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19439498 2009 Cytosolic Aryl sulfotransferase 4A1 interacts with the peptidyl prolyl cis-trans isomerase Pin1.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19125109 2009 Lack of exonic sulfotransferase 4A1 mutations in controls and schizophrenia cases.
18823757 2008 Association of Sult4A1 SNPs with psychopathology and cognition in patients with schizophrenia or schizoaffective disorder.
17425406 2007 Structural and chemical profiling of the human cytosolic sulfotransferases.
16152568 2005 Transmission disequilibrium suggests a role for the sulfotransferase-4A1 gene in schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623933 2003 Localization of a brain sulfotransferase, SULT4A1, in the human and rat brain: an immunohistochemical study.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12039030 2002 Highly conserved mouse and human brain sulfotransferases: molecular cloning, expression, and functional characterization.
11535246 2001 Human cytosolic sulphotransferases: genetics, characteristics, toxicological aspects.
11154739 2000 Sulfotransferases in the bioactivation of xenobiotics.
10720750 2000 Sulfotransferases: genetics and role in toxicology.
10698717 2000 Molecular cloning and expression of novel sulphotransferase-like cDNAs from human and rat brain.
10591208 1999 The DNA sequence of human chromosome 22.
9034160 1997 Sulfation and sulfotransferases 1: Sulfotransferase molecular biology: cDNAs and genes.