Property Summary

NCBI Gene PubMed Count 46
PubMed Score 169.24
PubTator Score 32.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
esophageal adenocarcinoma -2.500 2.0e-02
psoriasis 1.400 5.7e-12

Protein-protein Interaction (1)

Gene RIF (26)

PMID Text
26739637 Since 1'-hydroxyestragole exposure readily produced DNA injury in B-13/H cells, these data suggest that cholangiocarcinomas generated in rats fed estragole may be dependent, in part, on SULT2B1 activation of the 1'-hydroxyestragole metabolite.
26169578 It metabolizes breast cancer drugs like afimoxifene and endoxifen by sulfation.
26121319 Overexpression of SULT2B1b is an independent prognostic indicator and promotes cell growth and invasion in colorectal carcinoma.
24682418 This study identified specific germline variations in estradiol metabolism-related pathways, namely CYP1B1, SULT2B1, and HSD17B2, as novel prognostic markers that are cumulatively associated with increased risk of prostate cancer progression
24277929 Data indicate that cholesterol sulfate (CS) and SULT2B1b inhibited gluconeogenesis by targeting the gluconeogenic factor hepatocyte nuclear factor 4alpha (HNF4alpha) in both cell cultures and human SULT2B1b transgenic mice.
24020383 The SULT2B1 isoforms have a unique 50 amino acid carboxy-terminal sequence that is not present in the other human SULT isoforms (review).
23593328 SULT2B1b expression promotes proliferation of hepatocellular carcinoma cells in vitro and in vivo, which may contribute to the progression of HCC.
23579488 SULT2B1 is induced by calcitriol activated vitamin D receptor in human prostate cancer cells.
21840698 In HT29 cells expression of SULT2B1 was enhanced by probiotic fermentation supernatants without aleurone.
21146170 Sulfation of 25-hydroxycholesterol by SULT2B1b plays an important role in the maintenance of intracellular lipid homeostasis via the LXR/SREBP-1c signaling pathway in endothelial cells.
20329768 The Ca(2+)-bound form may be physiologically relevant for stressed cells with an elevated free calcium level.
20214802 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19243756 The expression of SULT2B1b mRNA in endometrial stromal cells is induced by progesterone and that in endometrial epithelial cells is induced by relaxin via the cAMP pathway.
18586095 Data show that SULT2B1b is localized in cytosol and nuclei of cancerous and normal breast tissue, and that African Americans had significantly more SULT2B1b in nuclei of epithelial cells of normal breast tissue compared to Caucasians.
17626250 SULT2B1 is involved in reulating prostate cell responsiveness to dehydroepiandrosterone and delta5-androstenediol.
17496163 Results show SULT2B1 polymorpohisms affect enzyme functions.
17347498 SULT2B1b, by acting on a variety of oxysterols, offers a potential pathway for modulating in vivo the injurious effects of these compounds.
15953604 Of five Sp1 elements identified in SULT2B1, two had regulatory activity utilizing immortalized human keratinocytes.
15878639 Immunohistochemical localization of SULT2B1b in human tissues showed expression in the cytoplasm of ciliated columnar or cuboidal epithelial cells in terminal bronchia.
15140224 confinement of SULT2B1b to the granular layer coincides with this being the area with the highest cholesterol sulfate content suggesting that the physiologic action of cholesterol sulfate is likely carried out in this region of the living epidermis
15063762 Observational study of gene-disease association. (HuGE Navigator)
14741047 Differential subcellular localization of SULT2B1b in prostate and placenta suggests that SULT2B1b may be differentially regulated and have different physiological functions in these two hormonally responsive human tissues
14676143 We have documented the presence of the enzyme (SULT2B1b) that sulfonates cholesterol in human platelets and examined the influence of plasma lipoproteins on the expression and activity of this enzyme
12923182 crystal structure of hydroxysteroid sulfotransferases SULT2B1a and SULT2B1b bound to the substrate donor product 3'-phosphoadenosine 5'-phosphate and acceptor substrate pregnenolone revealed a different catalytic binding orientation
12145317 alternative splicing of SULT2B1 results in cholesterol sulfotransferase or pregnenolone sulfotransferase

AA Sequence

MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPK      1 - 70
SGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAFFSSKA     71 - 140
KVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFITY    141 - 210
EELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGD    211 - 280
WKNHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPS    281 - 350
PSPGQASETPHPRPS                                                           351 - 365
//

Text Mined References (48)

PMID Year Title
26739637 2016 Progenitor-derived hepatocyte-like (B-13/H) cells metabolise 1'-hydroxyestragole to a genotoxic species via a SULT2B1-dependent mechanism.
26169578 2015 Sulfation of afimoxifene, endoxifen, raloxifene, and fulvestrant by the human cytosolic sulfotransferases (SULTs): A systematic analysis.
26121319 2015 Overexpression of SULT2B1b is an independent prognostic indicator and promotes cell growth and invasion in colorectal carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
24682418 2014 Steroidogenic germline polymorphism predictors of prostate cancer progression in the estradiol pathway.
24277929 2014 Cholesterol sulfate and cholesterol sulfotransferase inhibit gluconeogenesis by targeting hepatocyte nuclear factor 4?.
24020383 2013 SULT2B1: unique properties and characteristics of a hydroxysteroid sulfotransferase family.
23593328 2013 Hydroxysteroid sulfotransferase SULT2B1b promotes hepatocellular carcinoma cells proliferation in vitro and in vivo.
23579488 2013 SULT2B1b sulfotransferase: induction by vitamin D receptor and reduced expression in prostate cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21855633 2011 Site-directed mutagenesis of human cytosolic sulfotransferase (SULT) 2B1b to phospho-mimetic Ser348Asp results in an isoform with increased catalytic activity.
21840698 2012 Effects of synbiotic fermentation products on primary chemoprevention in human colon cells.
21146170 2011 Sulfation of 25-hydroxycholesterol by SULT2B1b decreases cellular lipids via the LXR/SREBP-1c signaling pathway in human aortic endothelial cells.
20329768 2010 Crystal structure of human senescence marker protein 30: insights linking structural, enzymatic, and physiological functions .
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19243756 2010 Expression and regulation of cholesterol sulfotransferase (SULT2B1b) in human endometrium.
19060904 2009 An empirical framework for binary interactome mapping.
18586095 2008 Sulfotransferase 2B1b in human breast: differences in subcellular localization in African American and Caucasian women.
17626250 2007 Inhibition of SULT2B1b expression alters effects of 3beta-hydroxysteroids on cell proliferation and steroid hormone receptor expression in human LNCaP prostate cancer cells.
17496163 2007 Human hydroxysteroid sulfotransferase SULT2B1 pharmacogenomics: gene sequence variation and functional genomics.
17425406 2007 Structural and chemical profiling of the human cytosolic sulfotransferases.
17347498 2007 Oxysterols are substrates for cholesterol sulfotransferase.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16855051 2006 Characterization of proline-serine-rich carboxyl terminus in human sulfotransferase 2B1b: immunogenicity, subcellular localization, kinetic properties, and phosphorylation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15953604 2005 Sp1 elements in SULT2B1b promoter and 5'-untranslated region of mRNA: Sp1/Sp2 induction and augmentation by histone deacetylase inhibition.
15878639 2005 Identification and immunohistochemical localization of Sulfotransferase 2B1b (SULT2B1b) in human lung.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15140224 2004 Expression of cholesterol sulfotransferase (SULT2B1b) in human skin and primary cultures of human epidermal keratinocytes.
15063762 2004 Genetic variations in humans associated with differences in the course of hepatitis C.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14741047 2004 Different subcellular localization of sulphotransferase 2B1b in human placenta and prostate.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676143 2004 Expression of cholesterol sulfotransferase (SULT2B1b) in human platelets.
12923182 2003 Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of pregnenolone and 3'-phosphoadenosine 5'-phosphate. Rationale for specificity differences between prototypical SULT2A1 and the SULT2BG1 isoforms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399026 2002 Differential xenoestrogen-sulfating activities of the human cytosolic sulfotransferases: molecular cloning, expression, and purification of human SULT2B1a and SULT2B1b sulfotransferases.
12145317 2002 Mutational analysis of human hydroxysteroid sulfotransferase SULT2B1 isoforms reveals that exon 1B of the SULT2B1 gene produces cholesterol sulfotransferase, whereas exon 1A yields pregnenolone sulfotransferase.
11594786 2001 Biochemical characterization and tissue distribution of human SULT2B1.
11535246 2001 Human cytosolic sulphotransferases: genetics, characteristics, toxicological aspects.
11457664 2001 Expression and characterization of the human 3 beta-hydroxysteroid sulfotransferases (SULT2B1a and SULT2B1b).
11416019 2001 Cholesterol and hydroxycholesterol sulfotransferases: identification, distinction from dehydroepiandrosterone sulfotransferase, and differential tissue expression.
11154739 2000 Sulfotransferases in the bioactivation of xenobiotics.
10720750 2000 Sulfotransferases: genetics and role in toxicology.
9799594 1998 Human hydroxysteroid sulfotransferase SULT2B1: two enzymes encoded by a single chromosome 19 gene.
9034160 1997 Sulfation and sulfotransferases 1: Sulfotransferase molecular biology: cDNAs and genes.