Property Summary

NCBI Gene PubMed Count 30
PubMed Score 118.69
PubTator Score 13.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis 3.048 3.7e-02
Barrett's esophagus 2.800 5.0e-02
colon cancer 3.000 1.5e-02
COPD 1.500 2.6e-02
intraductal papillary-mucinous adenoma (... 5.400 1.8e-04
intraductal papillary-mucinous neoplasm ... 4.300 7.4e-03
lung adenocarcinoma 2.000 1.2e-09
lung cancer -1.200 4.0e-03
lung carcinoma -1.700 2.6e-11
malignant mesothelioma 1.100 3.1e-04
nephrosclerosis -1.114 4.6e-02
osteosarcoma -1.336 1.9e-02
ovarian cancer 1.400 2.6e-06
pancreatic cancer 2.300 3.8e-04

Synonym

Accession O00338 B2R813 Q53SG4 ST1C2
Symbols ST1C1
ST1C2
SULT1C1
humSULTC2

Gene

PDB

3BFX  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEK      1 - 70
CQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSY     71 - 140
YHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQ    141 - 210
FMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEI    211 - 280
YRRKMEGTSINFCMEL                                                          281 - 296
//

Text Mined References (32)

PMID Year Title