Property Summary

NCBI Gene PubMed Count 20
PubMed Score 24.15
PubTator Score 17.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.100 9.3e-07
tuberculosis 1.600 4.7e-07
intraductal papillary-mucinous adenoma (... 2.700 3.8e-03
intraductal papillary-mucinous carcinoma... 1.500 5.0e-02
colon cancer -3.200 3.4e-02
lung adenocarcinoma -1.100 7.4e-12
lung carcinoma -1.500 4.6e-10

Synonym

Accession O43704 O15497 Q96FI1 Q9UK34 ST1B1
Symbols ST1B1
ST1B2
SULT1B2

Gene

PANTHER Protein Class (1)

PDB

2Z5F   3CKL  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
19898482 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
16804942 crystal structures of two members of SULT1 family, SULT1B1 and SULT1C1, both in complex with the product of the PAPS cofactor, adenosine-3-5-diphosphate (PAP).
11688987 linkage to SULT1E1 and a SULT1D1 pseudogene on chromosome 4

AA Sequence

MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKC      1 - 70
KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSY     71 - 140
YHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIR    141 - 210
FLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAI    211 - 280
YETEMSKTALQFRTEI                                                          281 - 296
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20056724 2010 Phase II metabolism of hesperetin by individual UDP-glucuronosyltransferases and sulfotransferases and rat and human tissue samples.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19548878 2009 Inhibitory effects of kynurenic acid, a tryptophan metabolite, and its derivatives on cytosolic sulfotransferases.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
17425406 2007 Structural and chemical profiling of the human cytosolic sulfotransferases.
16804942 2006 Crystal structures of human sulfotransferases SULT1B1 and SULT1C1 complexed with the cofactor product adenosine-3'- 5'-diphosphate (PAP).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11688987 2001 Structure and localization of the human SULT1B1 gene: neighborhood to SULT1E1 and a SULT1D pseudogene.
11535246 2001 Human cytosolic sulphotransferases: genetics, characteristics, toxicological aspects.
11368519 2001 Molecular cloning, expression, and characterization of a canine sulfotransferase that is a human ST1B2 ortholog.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11154739 2000 Sulfotransferases in the bioactivation of xenobiotics.
10720750 2000 Sulfotransferases: genetics and role in toxicology.
9463486 1998 Expression and characterization of a novel thyroid hormone-sulfating form of cytosolic sulfotransferase from human liver.
9443824 1997 Molecular cloning and characterization of rat ST1B1 and human ST1B2 cDNAs, encoding thyroid hormone sulfotransferases.
9034160 1997 Sulfation and sulfotransferases 1: Sulfotransferase molecular biology: cDNAs and genes.