Property Summary

NCBI Gene PubMed Count 57
PubMed Score 249.09
PubTator Score 637.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26611713 Sulfate metabolites R-6-S and R-4'-S were generated from raloxifene in SULT293 expression HEK293 cells. Cellular excretion of the raloxifene sulfates was mainly mediated by BCRP and MRP4.
26291395 This study aimed to establish SULT1A3 stably transfected HEK293 cells, and to determine the contributions of BCRP and MRP transporters to excretion of chrysin and apigenin sulfates.
26067475 A systematic analysis showed that three of the twelve human SULTs, SULT1A1, SULT1A3 and SULT1C4, displayed the strongest sulphating activity towards acetaminophen.
25941087 Genetic polymorphism of SULT1A3,a major ritodrine-sulfating SULT, appeared to exert a dramatic effect on the sulfating activity of SULT1A3 allozymes.
24692077 The common SULT1A3 single-nucleotide polymorphism 105A>G is not an important determinant of salbutamol enantiomer pharmacokinetics under normal clinical use and does not place some individuals at greater risk of accumulation in the body.
24136195 Taken together, these results show that dopamine can induce its own metabolism and protect neuron-like cells from damage, suggesting that SULT1A3 activity may be a risk factor for dopamine-dependent neurodegenerative diseases.
24039991 Data indicate that protein-ligand interaction energy by using docking Quantitative Structure-Activity Relationships(QSAR) models showed accuracy of 67.28%, 78.00% and 75.46%, for the isoforms SULT1A1, SULT1A3 and SULT1E1, respectively.
22949271 The expression of ALDOA and/or SULT1A3 is significantly higher.
22352375 Studies indicate that SULT1A3 is the main isoform responsible for flavonoid sulfonation in the Caco-2 cells.
21168432 SULT1A3 has a role in the inactivation of excess chlorotyrosine and nitrotyrosine during inflammation in lung endothelial and epithelial cells.
19447296 Concerted action of cytosolic sulfotransferase, SULT1A3, and catechol-O-methyltransferase in the metabolism of dopamine in SK-N-MC human neuroblastoma cells. SULT1A3 is the major enzyme responsible for the sulfation of both dopamine and 3-methyldopamine.
17963788 data from this study shows that the human SULT1A3 gene is inducible by glucocorticoids through a glucocorticoid receptor-mediated mechanism and the glucocorticoid response element at position (-1211 to -1193) is necessary for this induction.
17002600 Of the 11 human cytosol sulfotransferase enzymes tested, only SULT1A3 displayed sulfating activity toward nitrotyrosine. The pH-dependence and kinetic constants of SULT1A3 with nitrotyrosine or dopamine as substrate were determined.
16083857 X-ray crystallographic analysis of SULT1A3 complexed with dopamine and 3'-phosphoadenosine 5'-phosphate
15358107 2 SULT1A3 genes were present on chromosome 16 in all DNA samples studied.
14871892 For SULT1A3, substrate inhibition is found for dopamine but not with pNP. Based on modeling and kinetic studies, it is proposed that substrate inhibition by dopamine in SULT1A3 is caused by binding of two dopamine molecules in the active site.
14622112 Eight single nucleotide polymorphisms were observed in African American[AA] and five in Caucasian-American subjects, including one (Lys234Asn) that was observed only in AA subjects with an allele frequency of 4.2%
12761191 the differential substrate specificity of the two enzymes M-PST and P-PST for the thirteen drug compounds tested
12424257 structure-function relationships in the stereospecific and manganese-dependent 3,4-dihydroxyphenylalanine/tyrosine-sulfating activity of human monoamine-form phenol sulfotransferase, SULT1A3
12228221 M-PST is involved in protective and detoxification mechanisms that may operate in neurodegenerative processes in the brain

AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKC      1 - 70
NRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYY     71 - 140
HFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF    141 - 210
VGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY    211 - 280
AEKMAGCSLSFRSEL                                                           281 - 295
//

Text Mined References (59)

PMID Year Title
26611713 2015 Sulfonation of raloxifene in HEK293 cells overexpressing SULT1A3: Involvement of breast cancer resistance protein (BCRP/ABCG2) and multidrug resistance-associated protein 4 (MRP4/ABCC4) in excretion of sulfate metabolites.
26291395 2015 Efflux transport of chrysin and apigenin sulfates in HEK293 cells overexpressing SULT1A3: The role of multidrug resistance-associated protein 4 (MRP4/ABCC4).
26067475 2015 Sulphation of acetaminophen by the human cytosolic sulfotransferases: a systematic analysis.
25941087 2015 Sulfation of ritodrine by the human cytosolic sulfotransferases (SULTs): Effects of SULT1A3 genetic polymorphism.
25416956 2014 A proteome-scale map of the human interactome network.
24692077 2015 SULT 1A3 single-nucleotide polymorphism and the single dose pharmacokinetics of inhaled salbutamol enantiomers: are some athletes at risk of higher urine levels?
24136195 2013 Cytosolic sulfotransferase 1A3 is induced by dopamine and protects neuronal cells from dopamine toxicity: role of D1 receptor-N-methyl-D-aspartate receptor coupling.
24039991 2013 In silico mechanistic profiling to probe small molecule binding to sulfotransferases.
22949271 2014 Proteomic profiling of osteosarcoma cells identifies ALDOA and SULT1A3 as negative survival markers of human osteosarcoma.
22352375 2012 SULT1A3-mediated regiospecific 7-O-sulfation of flavonoids in Caco-2 cells can be explained by the relevant molecular docking studies.
21269460 2011 Initial characterization of the human central proteome.
21168432 2011 Sulfation of chlorotyrosine and nitrotyrosine by human lung endothelial and epithelial cells: role of the human SULT1A3.
20056724 2010 Phase II metabolism of hesperetin by individual UDP-glucuronosyltransferases and sulfotransferases and rat and human tissue samples.
19679676 2009 Quantitative evaluation of the expression and activity of five major sulfotransferases (SULTs) in human tissues: the SULT "pie".
19646966 2009 Expression and functional activities of selected sulfotransferase isoforms in BeWo cells and primary cytotrophoblast cells.
19447296 2009 Concerted action of the cytosolic sulfotransferase, SULT1A3, and catechol-O-methyltransferase in the metabolism of dopamine in SK-N-MC human neuroblastoma cells.
19178765 2009 In-vitro sulfation of piceatannol by human liver cytosol and recombinant sulfotransferases.
19171676 2009 Expression and localization of cytosolic sulfotransferase (SULT) 1A1 and SULT1A3 in normal human brain.
19131519 2009 Sulfation of o-demethyl apixaban: enzyme identification and species comparison.
19122289 2009 Inhibitory effects of herbal extracts on the activity of human sulfotransferase isoform sulfotransferase 1A3 (SULT1A3).
17963788 2007 Induction of human sulfotransferase 1A3 (SULT1A3) by glucocorticoids.
17908235 2007 Hydroxylated serotonin and dopamine as substrates and inhibitors for human cytosolic SULT1A3.
17891604 2007 Sulfation of nitrotyrosine: biochemistry and functional implications.
17876860 2007 Inhibitory effects of various beverages on human recombinant sulfotransferase isoforms SULT1A1 and SULT1A3.
17433394 2007 Cigarette smoke toxicants as substrates and inhibitors for human cytosolic SULTs.
17425406 2007 Structural and chemical profiling of the human cytosolic sulfotransferases.
17002600 2007 Generation and release of nitrotyrosine O-sulfate by HepG2 human hepatoma cells upon SIN-1 stimulation: identification of SULT1A3 as the enzyme responsible.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16083857 2005 Crystal structure of human sulfotransferase SULT1A3 in complex with dopamine and 3'-phosphoadenosine 5'-phosphate.
15752422 2005 Phylogenomic approaches to common problems encountered in the analysis of low copy repeats: the sulfotransferase 1A gene family example.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358107 2004 Human SULT1A3 pharmacogenetics: gene duplication and functional genomic studies.
14871892 2004 Active site mutations and substrate inhibition in human sulfotransferase 1A1 and 1A3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14622112 2003 Human catecholamine sulfotransferase (SULT1A3) pharmacogenetics: functional genetic polymorphism.
12761191 2003 Differential roles of human monoamine (M)-form and simple phenol (P)-form phenol sulfotransferases in drug metabolism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12424257 2003 Structure-function relationships in the stereospecific and manganese-dependent 3,4-dihydroxyphenylalanine/tyrosine-sulfating activity of human monoamine-form phenol sulfotransferase, SULT1A3.
12228221 2002 Manganese stimulation and stereospecificity of the Dopa (3,4-dihydroxyphenylalanine)/tyrosine-sulfating activity of human monoamine-form phenol sulfotransferase. Kinetic studies of the mechanism using wild-type and mutant enzymes.
11535246 2001 Human cytosolic sulphotransferases: genetics, characteristics, toxicological aspects.
11154739 2000 Sulfotransferases in the bioactivation of xenobiotics.
10720750 2000 Sulfotransferases: genetics and role in toxicology.
10617600 2000 Sulfation of "estrogenic" alkylphenols and 17beta-estradiol by human platelet phenol sulfotransferases.
10608851 1999 X-ray crystal structure of human dopamine sulfotransferase, SULT1A3. Molecular modeling and quantitative structure-activity relationship analysis demonstrate a molecular basis for sulfotransferase substrate specificity.
10543947 1999 Crystal structure of human catecholamine sulfotransferase.
10336855 1999 Kinetic properties of human dopamine sulfotransferase (SULT1A3) expressed in prokaryotic and eukaryotic systems: comparison with the recombinant enzyme purified from Escherichia coli.
9855620 1998 A single amino acid, glu146, governs the substrate specificity of a human dopamine sulfotransferase, SULT1A3.
9034160 1997 Sulfation and sulfotransferases 1: Sulfotransferase molecular biology: cDNAs and genes.
8912648 1996 Genomic organization and DNA sequences of two human phenol sulfotransferase genes (STP1 and STP2) on the short arm of chromosome 16.
8363592 1993 Identification of two human brain aryl sulfotransferase cDNAs.
8187949 1994 Cloning and expression of cDNA encoding human placental estrogen sulfotransferase.
8117269 1994 Human liver thermolabile phenol sulfotransferase: cDNA cloning, expression and characterization.
8093002 1994 Functional characterization of two human sulphotransferase cDNAs that encode monoamine- and phenol-sulphating forms of phenol sulphotransferase: substrate kinetics, thermal-stability and inhibitor-sensitivity studies.
7961757 1994 Structure of human estrogen and aryl sulfotransferase gene. Two mRNA species issued from a single gene.
7829089 1994 Thermolabile phenol sulfotransferase gene (STM): localization to human chromosome 16p11.2.
7802665 1994 Genomic organization and DNA sequence of the human catecholamine-sulfating phenol sulfotransferase gene (STM).
7695643 1995 Human platelet phenolsulfotransferases: cDNA cloning, stable expression in V79 cells and identification of a novel allelic variant of the phenol-sulfating form.
7695637 1995 Human thermolabile phenol sulfotransferase gene (STM): molecular cloning and structural characterization.