Property Summary

NCBI Gene PubMed Count 47
PubMed Score 62.91
PubTator Score 52.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytic glioma 2.100 4.5e-03
oligodendroglioma 2.800 1.6e-03
glioblastoma 1.700 5.7e-03
osteosarcoma -1.451 3.5e-02
cystic fibrosis -1.042 2.7e-04
medulloblastoma, large-cell -1.300 4.6e-02
primitive neuroectodermal tumor 1.700 3.0e-03
juvenile dermatomyositis 1.192 2.8e-10
adrenocortical carcinoma 2.482 5.2e-04
primary pancreatic ductal adenocarcinoma 3.300 4.7e-05
tuberculosis and treatment for 3 months 1.300 4.8e-04
non-small cell lung cancer 1.515 1.9e-09
intraductal papillary-mucinous neoplasm ... 2.200 1.2e-02
X-linked cerebral adrenoleukodystrophy 2.300 3.2e-02
active ulcerative colitis 1.076 2.7e-02
pancreatic cancer 3.200 3.4e-04
interstitial cystitis 2.600 1.7e-05
pediatric high grade glioma 1.700 3.7e-04
pilocytic astrocytoma 2.800 2.7e-09
invasive ductal carcinoma 2.438 6.7e-07
Polycystic Ovary Syndrome -1.197 4.7e-02
Breast cancer 1.100 1.3e-02
gastric carcinoma 2.400 1.9e-02
ovarian cancer -2.700 2.9e-07
pituitary cancer -2.700 2.0e-08

Pathway (1)

Gene RIF (37)

PMID Text
26882224 Tumor expression of SULF2 may affect prognosis in NSCLC, while blood SULF2 levels may have a significant role in the diagnosis of this fatal disease.
26708018 Our data confirmed that Sulf2 promoted breast cancer progression and regulated the expression of tumor-related genes in breast cancer.
25887999 SULF2 have a pro-tumorigenic effect in DU-145 and PC3 cancer cells, suggesting an important role of this enzyme in prostatic cancer metastasis.
25477293 Results show that SULF1 or SULF2 overexpression contributes to colorectal cancer cell proliferation, migration, and invasion.
25444749 SULF2 blood levels increased with age in both healthy and cirrhosis patients.SULF2 blood level was higher in cirrhosis patients than healthy individuals.
25325976 SULF2 expression in human tumor tissue and cell lines, was assessed.
25164011 Our findings define Sulf-2 as a novel positive regulator of neuroblastoma pathogenicity that contributes to MYCN oncogenicity.
25127119 Substrate specificity of human SULF2.
25036960 pectin induced the expression of HSulf-2 through the interaction with fibronectin, alpha5beta1 integrin, and ERK1/2
24726914 SULF1/SULF2 splice variants regulate pancreatic tumor progression.
24359226 SULF2 promoter methylation was associated with irinotecan sensitivity in gastric carcinoma.
24339435 The SULF2 single nucleotide polymorphism was reproducibly associated with lower fasting plasma triglycerides levels in obese type 2 diabetic subjects.
24278138 Results indicate that the genetic variation rs2281279 in SULF2 associates with postprandial clearance of remnant TRLs and triglyceride levels in healthy subjects.
24124496 SULF2 methylation is negatively associated with cisplatin sensitivity in vitro.
23950901 Knockdown of SULF2 in human corneal epithelial cell line slowed migration, which was restored by overexpression of either mouse SULF2 or human SULF1.
23480519 Ectopic expression of SULF1 or SULF2 in HeLa cells, which decreases cell surface heparan sulfate proteoglycan sulfation, diminished Chlamydia muridarum binding and decreased vacuole formation.
23457216 studied the functional consequences of HSulf-2 activity on fibroblast growth factor (FGF)-induced mitogenesis and found that the enzyme could differentially regulate FGF1 and FGF2 activities
23418199 Sulf2 is overexpressed in idiopathic pulmonary fibrosis and may play a role in regulating TGF-beta1 signaling in type II alveolar epithelial cells.
22410125 Sulf-2 expression is be critical for human breast cancer progression.
22293178 Heparan sulfate sulfatase SULF2 regulates PDGFRalpha signaling and growth in human and mouse malignant glioma
22158045 genes and pathways modulated by epigenetic inactivation of SULF2 and the effects on sensitivity to chemotherapy were characterized in lung cancer in vitro and in vivo; silencing SULF2 primarily increased expression of interferon-inducible genes including ISG15
21968018 This study demonstrates that unlike normal adult lung with little or no SULF2 expression, this enzyme is expressed at high levels in most lung tumours showing differential cellular distribution of full length and shorter SULF2 variants in such tumours.
21599997 SULF1 and SULF2 are overexpressed in various human cancer types and can be associated to progression and prognosis.
21347431 enzymatic activity of HSulf2
21040406 The prosurvival, anti-apoptotic effect of SULF2 in hepatocellular carcinoma is mediated through activation of the PI3K/Akt pathway.
20725905 Mechanism mediating the oncogenic function of SULF2 in human hepatoma that includes GPC3-mediated activation of Wnt signaling.
20707913 Loss of SULF2 is associated with breast cancer.
19855436 Our findings support an essential role for Sulf-2 in lung cancer
19520866 analysis of the subdomain organization of sulf-1 and sulf-2
19190338 Genetic and pharmacologic perturbation of p53 directly influences SULF2 expression in tumor cell lines.
18687675 Sulf1 and Sulf2 are two heparan sulfate 6-O-endosulfatases that regulate the activity of multiple growth factors, such as fibroblast growth factor and Wnt, and are essential for mammalian development and survival
18507859 Increased sulf-2 mRNA and protein levels may change the sulfation patterns of heparan sulfate proteoglycans and growth factor activities and thus contribute to abnormal chondrocyte activation and cartilage degradation in osteoarthritis.
16417632 Binding of VEGF, FGF-1, & certain chemokines (SDF-1 & SLC) to immobilized heparin was abolished or diminished by pre-treating the heparin with HSulf-2. Recombinant or native HSulf-2 released these soluble proteins from their association with heparin.
16331886 Purified recombinant Sulf-2 promoted angiogenesis in the chick chorioallantoic membrane assay.
16192265 HSulf-1 and HSulf-2 have roles in inhibiting myeloma tumor growth
16192265 HSulf-1 (SULF1) and HSulf-2 (SULF2) are potent inhibitors of myeloma tumor growth in vivo.
12368295 Sulfs are extracellular endosulfatases with strong potential for modulating the interactions of heparan sulfate proteoglycans in the extracellular microenvironment

AA Sequence

MGPPSLVLCLLSATVFSLLGGSSAFLSHHRLKGRFQRDRRNIRPNIILVLTDDQDVELGSMQVMNKTRRI      1 - 70
MEQGGAHFINAFVTTPMCCPSRSSILTGKYVHNHNTYTNNENCSSPSWQAQHESRTFAVYLNSTGYRTAF     71 - 140
FGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDSVSFFRTSKKM    141 - 210
YPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQ    211 - 280
RKRLQTLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNV    281 - 350
EAGCLNPHIVLNIDLAPTILDIAGLDIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLL    351 - 420
HKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATGKLKLHKCKGPMRLGGSRALS    421 - 490
NLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR    491 - 560
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLH    561 - 630
IDHEIETLQNKIKNLREVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLRE    631 - 700
QKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFL    701 - 770
FCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYE    771 - 840
QYRQFQRRKWPEMKRPSSKSLGQLWEGWEG                                            841 - 870
//

Text Mined References (50)

PMID Year Title
26882224 2016 SULF2 Expression Is a Potential Diagnostic and Prognostic Marker in Lung Cancer.
26708018 2016 Sulfatase 2 promotes breast cancer progression through regulating some tumor-related factors.
25887999 2015 SULF2 overexpression positively regulates tumorigenicity of human prostate cancer cells.
25477293 2015 Enhanced tumorigenic potential of colorectal cancer cells by extracellular sulfatases.
25444749 2015 SULF2, a heparan sulfate endosulfatase, is present in the blood of healthy individuals and increases in cirrhosis.
25325976 2015 Measuring sulfatase expression and invasion in glioblastoma.
25164011 2014 MYCN-dependent expression of sulfatase-2 regulates neuroblastoma cell survival.
25127119 2014 Oligosaccharide substrate preferences of human extracellular sulfatase Sulf2 using liquid chromatography-mass spectrometry based glycomics approaches.
25036960 2014 Pectin of Prunus domestica L. alters sulfated structure of cell-surface heparan sulfate in differentiated Caco-2 cells through stimulation of heparan sulfate 6-O-endosulfatase-2.
24726914 2014 SULF1/SULF2 splice variants differentially regulate pancreatic tumour growth progression.
24359226 2013 Correlation between the methylation of SULF2 and WRN promoter and the irinotecan chemosensitivity in gastric cancer.
24339435 2014 SULF2 strongly prediposes to fasting and postprandial triglycerides in patients with obesity and type 2 diabetes mellitus.
24278138 2013 Genetic variation in SULF2 is associated with postprandial clearance of triglyceride-rich remnant particles and triglyceride levels in healthy subjects.
24124496 2013 SULF2 methylation is associated with in vitro cisplatin sensitivity and clinical efficacy for gastric cancer patients treated with a modified FOLFOX regimen.
23950901 2013 The SULFs, extracellular sulfatases for heparan sulfate, promote the migration of corneal epithelial cells during wound repair.
23480519 2013 Endosulfatases SULF1 and SULF2 limit Chlamydia muridarum infection.
23457216 2013 HSulf sulfatases catalyze processive and oriented 6-O-desulfation of heparan sulfate that differentially regulates fibroblast growth factor activity.
23418199 2013 Overexpression of Sulf2 in idiopathic pulmonary fibrosis.
22410125 2012 Silencing of HSulf-2 expression in MCF10DCIS.com cells attenuate ductal carcinoma in situ progression to invasive ductal carcinoma in vivo.
22293178 2012 Heparan sulfate sulfatase SULF2 regulates PDGFR? signaling and growth in human and mouse malignant glioma.
22158045 2012 SULF2 methylation is prognostic for lung cancer survival and increases sensitivity to topoisomerase-I inhibitors via induction of ISG15.
21968018 2011 Sulf2 gene is alternatively spliced in mammalian developing and tumour tissues with functional implications.
21599997 2011 SULFs in human neoplasia: implication as progression and prognosis factors.
21441931 2011 Common variation in GPC5 is associated with acquired nephrotic syndrome.
21347431 2011 Glycomics analysis of mammalian heparan sulfates modified by the human extracellular sulfatase HSulf2.
21040406 2010 Sulfatase 2 protects hepatocellular carcinoma cells against apoptosis induced by the PI3K inhibitor LY294002 and ERK and JNK kinase inhibitors.
20725905 2010 The oncogenic effect of sulfatase 2 in human hepatocellular carcinoma is mediated in part by glypican 3-dependent Wnt activation.
20707913 2010 Human Sulfatase 2 inhibits in vivo tumor growth of MDA-MB-231 human breast cancer xenografts.
19855436 2010 Sulf-2, a heparan sulfate endosulfatase, promotes human lung carcinogenesis.
19520866 2009 Functional consequences of the subdomain organization of the sulfs.
19190338 2009 Identification of SULF2 as a novel transcriptional target of p53 by use of integrated genomic analyses.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18937294 2008 Genome-wide association scan of the time to onset of attention deficit hyperactivity disorder.
18687675 2008 Sulf loss influences N-, 2-O-, and 6-O-sulfation of multiple heparan sulfate proteoglycans and modulates fibroblast growth factor signaling.
18507859 2008 Expression of novel extracellular sulfatases Sulf-1 and Sulf-2 in normal and osteoarthritic articular cartilage.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16417632 2006 HSulf-2, an extracellular endoglucosamine-6-sulfatase, selectively mobilizes heparin-bound growth factors and chemokines: effects on VEGF, FGF-1, and SDF-1.
16331886 2005 Sulf-2, a proangiogenic heparan sulfate endosulfatase, is upregulated in breast cancer.
16192265 2005 HSulf-1 and HSulf-2 are potent inhibitors of myeloma tumor growth in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12368295 2002 Cloning and characterization of two extracellular heparin-degrading endosulfatases in mice and humans.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11549316 2001 A high-resolution 6.0-megabase transcript map of the type 2 diabetes susceptibility region on human chromosome 20.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.