Property Summary

NCBI Gene PubMed Count 55
PubMed Score 67.04
PubTator Score 52.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis 1.076 2.7e-02
adrenocortical carcinoma 2.171 1.4e-04
astrocytic glioma 2.000 6.8e-03
Astrocytoma, Pilocytic 2.400 9.5e-11
Breast cancer 1.100 1.3e-02
cystic fibrosis -1.042 2.7e-04
gastric carcinoma 2.400 1.9e-02
glioblastoma 1.300 6.3e-05
interstitial cystitis 1.800 5.1e-03
intraductal papillary-mucinous neoplasm ... 2.200 1.2e-02
invasive ductal carcinoma 2.438 6.7e-07
juvenile dermatomyositis 1.192 2.8e-10
medulloblastoma, large-cell -1.300 4.6e-02
non-small cell lung cancer 1.214 1.5e-07
oligodendroglioma 2.500 2.9e-03
osteosarcoma -1.451 3.5e-02
ovarian cancer -2.700 2.9e-07
pancreatic cancer 1.500 8.2e-04
pediatric high grade glioma 1.200 3.5e-03
pituitary cancer -2.700 2.0e-08
Polycystic ovary syndrome -1.197 4.7e-02
primary pancreatic ductal adenocarcinoma 3.300 4.7e-05
primitive neuroectodermal tumor 1.400 6.1e-03
tuberculosis 1.100 1.1e-03
X-linked cerebral adrenoleukodystrophy 2.300 3.2e-02

Gene RIF (45)

AA Sequence

MGPPSLVLCLLSATVFSLLGGSSAFLSHHRLKGRFQRDRRNIRPNIILVLTDDQDVELGSMQVMNKTRRI      1 - 70
MEQGGAHFINAFVTTPMCCPSRSSILTGKYVHNHNTYTNNENCSSPSWQAQHESRTFAVYLNSTGYRTAF     71 - 140
FGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDSVSFFRTSKKM    141 - 210
YPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQ    211 - 280
RKRLQTLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNV    281 - 350
EAGCLNPHIVLNIDLAPTILDIAGLDIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLL    351 - 420
HKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATGKLKLHKCKGPMRLGGSRALS    421 - 490
NLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR    491 - 560
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLH    561 - 630
IDHEIETLQNKIKNLREVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLRE    631 - 700
QKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFL    701 - 770
FCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYE    771 - 840
QYRQFQRRKWPEMKRPSSKSLGQLWEGWEG                                            841 - 870
//

Text Mined References (58)

PMID Year Title