Property Summary

NCBI Gene PubMed Count 96
PubMed Score 89.48
PubTator Score 86.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
malignant mesothelioma -5.000 7.3e-09
astrocytoma 2.300 4.2e-04
cutaneous lupus erythematosus 2.000 4.8e-03
psoriasis -1.900 3.6e-04
osteosarcoma 2.513 1.8e-03
posterior fossa group B ependymoma 1.900 1.2e-03
cystic fibrosis 3.601 4.3e-07
glioblastoma 2.400 2.6e-02
medulloblastoma, large-cell -1.400 1.2e-02
Duchenne muscular dystrophy 1.075 3.1e-08
primary pancreatic ductal adenocarcinoma 4.872 1.6e-05
non-small cell lung cancer 3.659 1.4e-25
X-linked cerebral adrenoleukodystrophy 1.600 4.6e-02
colon cancer 1.300 3.6e-02
lung cancer 3.600 8.3e-07
pancreatic cancer 4.800 1.3e-05
breast carcinoma 2.000 1.1e-31
Breast cancer 3.100 2.6e-02
interstitial cystitis 2.500 1.8e-05
lung adenocarcinoma 2.642 5.6e-07
pediatric high grade glioma 1.700 9.0e-03
pilocytic astrocytoma 3.500 1.9e-08
primary Sjogren syndrome 1.400 1.9e-03
invasive ductal carcinoma 3.965 2.6e-06
nasopharyngeal carcinoma 2.300 1.6e-04
gastric carcinoma 3.800 9.9e-03
ductal carcinoma in situ 2.100 5.2e-03
ovarian cancer -3.800 6.8e-08

Pathway (1)

Gene RIF (43)

PMID Text
25477293 Results show that SULF1 or SULF2 overexpression contributes to colorectal cancer cell proliferation, migration, and invasion.
25469740 findings show an upregulation of SULF1 in degenerative discs for the first time, and suggest that there is a link between SULF1 and disc degeneration
24970807 Data suggest that Sulfatase 1 (hSulf-1) may be a suitable target for cancer therapy.
24911625 identification of markers including SULF1 may improve detection of this disease at its earliest stages improving patient treatment and prognosis
24726914 SULF1/SULF2 splice variants regulate pancreatic tumor progression.
24596063 Loss of HSulf-1 expression promotes tumorigenicity in ovarian cancer through regulating Bim expression.
24322345 rs6990375 polymorphism of SULF1 gene could be one of the factors related to recurrent miscarriage in Iranian women.
23950901 Knockdown of SULF2 in human corneal epithelial cell line slowed migration, which was restored by overexpression of either mouse SULF2 or human SULF1.
23891937 Strong interaction depends on the presence of Sulf1-substrate groups.
23684551 miR-21-mediated suppression of both hSulf-1 and PTEN led to activation of AKT/ERK pathways and epithelial-mesenchymal transition in hepatocellular carcinoma, promoting tumor growth.
23480519 Ectopic expression of SULF1 or SULF2 in HeLa cells, which decreases cell surface heparan sulfate proteoglycan sulfation, diminished Chlamydia muridarum binding and decreased vacuole formation.
23457216 HSulf-1 and HSulf-2 share the same desulfation processs but with a different rate
23053899 inhibits proliferation and invasion of esophageal squamous cell carcinoma by decreasing heparin-binding growth factor signaling
22873647 HSULF-1 is expressed at lower levels in H292 lung cancer cells than in normal human alveolar cells and that its over-expression reduced cell viability in H292 cells by inducing apoptotic pathways, at least in part by inhibiting ERK/Akt signaling
22825572 these observations provide evidence that HPEI nanogels delivering HSulf-1 combined with DDP may have a promising application in the therapy of human ovarian cancer.
22653794 SULF1 may serve as a promising biomarker for patients with gastric carcinoma.
22524839 Sulf-1 protein expression is down-regulated in gastric cancer.
21722266 extracellular HSulf-1 may function as a negative regulator of proliferation and invasion in gastric cancer by suppressing Wnt/beta-catenin signaling at the cell surface.
21599997 SULF1 and SULF2 are overexpressed in various human cancer types and can be associated to progression and prognosis.
21266348 Data show that HSulf-1 depletion in breast cancer cells resulted in an increased and sustained bFGF2 (basic fibroblast growth factor) signaling and promoted cell migration and invasion under hypoxic conditions.
21228115 Phage microarrays containing colorectal cancer cDNA libraries were prepared to identify phage-expressed peptides recognized by tumor-specific autoantibodies from patient sera.
21214932 Genetic variations in SULF1 may play a role in ovarian cancer onset and prognosis.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20602915 Haploinsufficiency of SULF1 combined with haploinsufficiency of SLCO5A1 (or the altered expression of a neighboring gene through position effect) could be necessary in the pathogenesis of MSS.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19780053 The expression levels of four of the up-regulated genes, CXCL1, SPARC, SPP1 and SULF, were significantly higher in the cancerous tissue compared with the normal tissue (fold change 3.4-8.9).
19666466 Data show that specific regions of the Sulf1 hydrophilic domain (HD) influence different aspects of heparan sulfate binding, cellular localization, and enzyme function.
19520866 analysis of the subdomain organization of sulf-1 and sulf-2
19487294 vHNF1 acts as a repressor of HSulf-1 expression and might be a molecular target for ovarian cancer therapy.
19373441 Strategies targeting sulfatase 1(SULF1) or the interaction between SULF1 and the related sulfatase 2 will potentially be important in developing novel cancer therapies.
19006069 detection of the HSulf-1 promoter methylation in serum samples may have clinical implications in early detection and diagnosis of human breast and gastric cancers.
18687675 Sulf1 and Sulf2 are two heparan sulfate 6-O-endosulfatases that regulate the activity of multiple growth factors, such as fibroblast growth factor and Wnt, and are essential for mammalian development and survival
18507859 Increased sulf-1 expression may change the sulfation patterns of heparan sulfate proteoglycans and growth factor activities and thus contribute to abnormal chondrocyte activation and cartilage degradation in osteoarthritis.
18503048 Sulf1 is a TGF-beta1-responsive gene both in vitro and in vivo and may function as a negative regulator of TGF-beta1-induced fibrogenesis
17437011 The combined effects of heparanase and HSULF could account for the lack of biologically active HS in tumour cells rather than deficiencies in the biosynthetic enzymes.
17363371 Loss of HSulf-1 expression is associated with breast cancer
16192265 HSulf-1 and HSulf-2 have roles in inhibiting myeloma tumor growth
16192265 HSulf-1 (SULF1) and HSulf-2 (SULF2) are potent inhibitors of myeloma tumor growth in vivo.
15817123 High expression of Hsulf-1 occurs in the stromal elements as well as in the tumor cells in pancreatic cancer and interferes with heparin-binding growth factor signaling
14699503 Down-regulation of hSulf1 contributes to hepatocarcinogenesis by enhancing heparin-binding growth factor signaling and resistance to apoptosis.
12686563 modulates signaling by heparin-binding growth factors, and HSulf-1 down-regulation represents a novel mechanism by which cancer cells can enhance growth factor signaling
12368295 Sulfs are extracellular endosulfatases with strong potential for modulating the interactions of heparan sulfate proteoglycans in the extracellular microenvironment

AA Sequence

MKYSCCALVLAVLGTELLGSLCSTVRSPRFRGRIQQERKNIRPNIILVLTDDQDVELGSLQVMNKTRKIM      1 - 70
EHGGATFINAFVTTPMCCPSRSSMLTGKYVHNHNVYTNNENCSSPSWQAMHEPRTFAVYLNNTGYRTAFF     71 - 140
GKYLNEYNGSYIPPGWREWLGLIKNSRFYNYTVCRNGIKEKHGFDYAKDYFTDLITNESINYFKMSKRMY    141 - 210
PHRPVMMVISHAAPHGPEDSAPQFSKLYPNASQHITPSYNYAPNMDKHWIMQYTGPMLPIHMEFTNILQR    211 - 280
KRLQTLMSVDDSVERLYNMLVETGELENTYIIYTADHGYHIGQFGLVKGKSMPYDFDIRVPFFIRGPSVE    281 - 350
PGSIVPQIVLNIDLAPTILDIAGLDTPPDVDGKSVLKLLDPEKPGNRFRTNKKAKIWRDTFLVERGKFLR    351 - 420
KKEESSKNIQQSNHLPKYERVKELCQQARYQTACEQPGQKWQCIEDTSGKLRIHKCKGPSDLLTVRQSTR    421 - 490
NLYARGFHDKDKECSCRESGYRASRSQRKSQRQFLRNQGTPKYKPRFVHTRQTRSLSVEFEGEIYDINLE    491 - 560
EEEELQVLQPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPTTVRVTHKCFILPNDSIHCER    561 - 630
ELYQSARAWKDHKAYIDKEIEALQDKIKNLREVRGHLKRRKPEECSCSKQSYYNKEKGVKKQEKLKSHLH    631 - 700
PFKEAAQEVDSKLQLFKENNRRRKKERKEKRRQRKGEECSLPGLTCFTHDNNHWQTAPFWNLGSFCACTS    701 - 770
SNNNTYWCLRTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQ    771 - 840
CNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG                                           841 - 871
//

Text Mined References (97)

PMID Year Title
26131010 2015 SULF 1 gene polymorphism, rs6990375 is in significant association with fetus failure in IVF technique.
25863062 2015 Catch bond interaction between cell-surface sulfatase Sulf1 and glycosaminoglycans.
25681501 2015 Sulf1 has ligand-dependent effects on canonical and non-canonical Wnt signalling.
25477293 2015 Enhanced tumorigenic potential of colorectal cancer cells by extracellular sulfatases.
25469740 2015 Increased sulfatase 1 gene expression in degenerative intervertebral disc cells.
25325968 2015 The Sulfs: expression, purification, and substrate specificity.
25105093 2014 The Role of Heparanase and Sulfatases in the Modification of Heparan Sulfate Proteoglycans within the Tumor Microenvironment and Opportunities for Novel Cancer Therapeutics.
24970807 2014 Sulfatase 1 (hSulf-1) reverses basic fibroblast growth factor-stimulated signaling and inhibits growth of hepatocellular carcinoma in animal model.
24911625 2014 Association of the SNP rs2623047 in the HSPG modification enzyme SULF1 with an Australian Caucasian breast cancer cohort.
24782989 2014 Transcriptional Activity of Heparan Sulfate Biosynthetic Machinery is Specifically Impaired in Benign Prostate Hyperplasia and Prostate Cancer.
24726914 2014 SULF1/SULF2 splice variants differentially regulate pancreatic tumour growth progression.
24596063 2014 Loss of HSulf-1 expression enhances tumorigenicity by inhibiting Bim expression in ovarian cancer.
24322345 2014 The association of arylendosulfatase 1 (SULF1) gene polymorphism with recurrent miscarriage.
23950901 2013 The SULFs, extracellular sulfatases for heparan sulfate, promote the migration of corneal epithelial cells during wound repair.
23891937 2013 Cooperation of binding sites at the hydrophilic domain of cell-surface sulfatase Sulf1 allows for dynamic interaction of the enzyme with its substrate heparan sulfate.
23772371 2013 Role of Sulf1A in Wnt1- and Wnt6-induced growth regulation and myoblast hyper-elongation.
23684551 2013 MicroRNA-21 suppresses PTEN and hSulf-1 expression and promotes hepatocellular carcinoma progression through AKT/ERK pathways.
23480519 2013 Endosulfatases SULF1 and SULF2 limit Chlamydia muridarum infection.
23457216 2013 HSulf sulfatases catalyze processive and oriented 6-O-desulfation of heparan sulfate that differentially regulates fibroblast growth factor activity.
23418199 2013 Overexpression of Sulf2 in idiopathic pulmonary fibrosis.
23359864 2013 Role of heparan sulfatases in ovarian and breast cancer.
23182495 2013 An oncolytic adenovirus regulated by a radiation-inducible promoter selectively mediates hSulf-1 gene expression and mutually reinforces antitumor activity of I131-metuximab in hepatocellular carcinoma.
23136428 2012 Differential sulfation remodelling of heparan sulfate by extracellular 6-O-sulfatases regulates fibroblast growth factor-induced boundary formation by glial cells: implications for glial cell transplantation.
23074159 2012 Distinct expression patterns of Sulf1 and Hs6st1 spatially regulate heparan sulfate sulfation during prostate development.
23053899 2013 SULF1 inhibits proliferation and invasion of esophageal squamous cell carcinoma cells by decreasing heparin-binding growth factor signaling.
23000194 2012 Over-expression of human endosulfatase-1 exacerbates cadmium-induced injury to transformed human lung cells in vitro.
22906644 2012 Genome-wide DNA methylation profiling of CpG islands in hypospadias.
22903264 2012 Cartilage tumour progression is characterized by an increased expression of heparan sulphate 6O-sulphation-modifying enzymes.
22873647 2012 HSULF-1 inhibits ERK and AKT signaling and decreases cell viability in vitro in human lung epithelial cells.
22825572 2012 The enhanced antitumor effects of biodegradable cationic heparin-polyethyleneimine nanogels delivering HSulf-1 gene combined with cisplatin on ovarian cancer.
22700218 2012 Mammalian Sulf1 RNA alternative splicing and its significance to tumour growth regulation.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22653794 2012 Up-regulated expression of sulfatases (SULF1 and SULF2) as prognostic and metastasis predictive markers in human gastric cancer.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22524839 2012 Endo-sulfatase Sulf-1 protein expression is down-regulated in gastric cancer.
22429964 2012 Heparan sulfate subdomains that are degraded by Sulf accumulate in cerebral amyloid ß plaques of Alzheimer's disease: evidence from mouse models and patients.
22410212 2012 Exposure to common food additive carrageenan leads to reduced sulfatase activity and increase in sulfated glycosaminoglycans in human epithelial cells.
22304734 2012 Computational and biological evaluation of quinazolinone prodrug for targeting pancreatic cancer.
22198210 A review of transcriptome studies combined with data mining reveals novel potential markers of malignant pleural mesothelioma.
22086394 2012 Efficient inhibition of an intraperitoneal xenograft model of human ovarian cancer by HSulf-1 gene delivered by biodegradable cationic heparin-polyethyleneimine nanogels.
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
21853101 2011 hSulf-1 gene exhibits anticancer efficacy through negatively regulating VEGFR-2 signaling in human cancers.
21808097 2011 Gene expression profiling suggests a pathological role of human bone marrow-derived mesenchymal stem cells in aging-related skeletal diseases.
21732829 2011 Wnt signaling and Dupuytren's disease.
21722266 2011 HSulf-1 inhibits cell proliferation and invasion in human gastric cancer.
21599997 2011 SULFs in human neoplasia: implication as progression and prognosis factors.
21594647 2011 Curcumin suppresses growth of mesothelioma cells in vitro and in vivo, in part, by stimulating apoptosis.
21266348 2011 HSulf-1 modulates FGF2- and hypoxia-mediated migration and invasion of breast cancer cells.
21228115 2011 Identification of MST1/STK4 and SULF1 proteins as autoantibody targets for the diagnosis of colorectal cancer by using phage microarrays.
21214932 2011 Polymorphisms in the SULF1 gene are associated with early age of onset and survival of ovarian cancer.
21104785 2011 Sulfatase 1 and sulfatase 2 in hepatocellular carcinoma: associated signaling pathways, tumor phenotypes, and survival.
20855470 2011 Expression regulation and function of heparan sulfate 6-O-endosulfatases in the spermatogonial stem cell niche.
20816204 2010 Use of a phage display antibody to measure the enzymatic activity of the Sulfs.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20643830 2010 Sulfatase modifying factor 1-mediated fibroblast growth factor signaling primes hematopoietic multilineage development.
20602915 2010 Mesomelia-synostoses syndrome results from deletion of SULF1 and SLCO5A1 genes at 8q13.
20479257 2010 Extracellular sulfatases support cartilage homeostasis by regulating BMP and FGF signaling pathways.
20394677 Differential involvement of the extracellular 6-O-endosulfatases Sulf1 and Sulf2 in brain development and neuronal and behavioural plasticity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20084279 2010 Common genetic variants and risk for HPV persistence and progression to cervical cancer.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
19822709 2010 Direct detection of HSulf-1 and HSulf-2 activities on extracellular heparan sulfate and their inhibition by PI-88.
19780053 2010 Gene expression analysis identifies over-expression of CXCL1, SPARC, SPP1, and SULF1 in gastric cancer.
19666466 2009 Characterization of the human sulfatase Sulf1 and its high affinity heparin/heparan sulfate interaction domain.
19520866 2009 Functional consequences of the subdomain organization of the sulfs.
19487294 2009 Regulation of HSulf-1 expression by variant hepatic nuclear factor 1 in ovarian cancer.
19376607 2009 Additive effect of apicidin and doxorubicin in sulfatase 1 expressing hepatocellular carcinoma in vitro and in vivo.
19373441 2008 The tumor suppressor function of human sulfatase 1 (SULF1) in carcinogenesis.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19086847 2008 Heparin-degrading sulfatases in hepatocellular carcinoma: roles in pathogenesis and therapy targets.
19006069 2009 Promoter hypermethylation correlates with the Hsulf-1 silencing in human breast and gastric cancer.
18687675 2008 Sulf loss influences N-, 2-O-, and 6-O-sulfation of multiple heparan sulfate proteoglycans and modulates fibroblast growth factor signaling.
18507859 2008 Expression of novel extracellular sulfatases Sulf-1 and Sulf-2 in normal and osteoarthritic articular cartilage.
18503048 2008 Transforming growth factor-beta1 induces heparan sulfate 6-O-endosulfatase 1 expression in vitro and in vivo.
18213582 2008 Redundant function of the heparan sulfate 6-O-endosulfatases Sulf1 and Sulf2 during skeletal development.
17728400 2007 Transcriptome-wide analysis of blood vessels laser captured from human skin and chronic wound-edge tissue.
17720696 2007 SULF1 and SULF2 regulate heparan sulfate-mediated GDNF signaling for esophageal innervation.
17460759 2007 Extracellular sulfatases, elements of the Wnt signaling pathway, positively regulate growth and tumorigenicity of human pancreatic cancer cells.
17437011 2007 Heparan sulphate synthetic and editing enzymes in ovarian cancer.
17363371 2007 Loss of HSulf-1 expression enhances autocrine signaling mediated by amphiregulin in breast cancer.
17310998 2007 Epigenetic silencing of HSulf-1 in ovarian cancer:implications in chemoresistance.
17113870 2006 Measuring the activities of the Sulfs: two novel heparin/heparan sulfate endosulfatases.
17044071 2007 Distinctive gene expression of prostatic stromal cells cultured from diseased versus normal tissues.
16778174 2006 HSulf-1 inhibits angiogenesis and tumorigenesis in vivo.
16762634 2006 SULF1 inhibits tumor growth and potentiates the effects of histone deacetylase inhibitors in hepatocellular carcinoma.
16603650 2006 Hsulf-1 regulates growth and invasion of pancreatic cancer cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16192265 2005 HSulf-1 and HSulf-2 are potent inhibitors of myeloma tumor growth in vivo.
15817123 2005 Enhanced levels of Hsulf-1 interfere with heparin-binding growth factor signaling in pancreatic cancer.
14973553 2004 HSulf-1 modulates HGF-mediated tumor cell invasion and signaling in head and neck squamous carcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699503 2004 hSulf1 Sulfatase promotes apoptosis of hepatocellular cancer cells by decreasing heparin-binding growth factor signaling.
12686563 2003 Loss of HSulf-1 up-regulates heparin-binding growth factor signaling in cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12368295 2002 Cloning and characterization of two extracellular heparin-degrading endosulfatases in mice and humans.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.