Property Summary

NCBI Gene PubMed Count 33
PubMed Score 9.74
PubTator Score 35.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
gastric cancer 1.200 3.2e-04
osteosarcoma -2.129 1.1e-07
glioblastoma -2.100 8.7e-05
atypical teratoid / rhabdoid tumor -1.500 4.0e-05
medulloblastoma -1.100 1.3e-04
medulloblastoma, large-cell -1.900 4.8e-05
Amyotrophic Lateral Sclerosis 1.202 6.2e-06
non-small cell lung cancer -1.328 7.9e-15
Breast cancer 2.700 2.4e-02
adult high grade glioma -1.800 1.1e-03
psoriasis -1.100 1.7e-23
invasive ductal carcinoma -1.500 7.7e-03
ovarian cancer -2.400 4.9e-07

Gene RIF (14)

PMID Text
23935490 Data suggest that SspH2 (ubiquitin ligase effector from Salmonella typhimurium) ubiquitination activity and protein stability is enhanced by SGT1.
23440515 our data revealed a previously uncovered role of SGT1 in gastric cancer development, and suggested that SGT1 could be a promising anti-cancer target to against gastric cancer
23184943 Chp-1 and melusin can interact with cochaperones PP5 and Sgt1 and with each other in an ATP-dependent manner
22869522 Plk1 is required for the kinetochore localization of Sgt1 and phosphorylates serine 331 of Sgt1 at the kinetochores.
21864708 S100A6-Ca(2+)-mediated Sgt1 dephosphorylation promotes its nuclear translocation, most likely due to disruption of the Sgt1-Hsp90 complex
20404110 These findings support a novel role for Hsp90-Sgt1 chaperones in ensuring the fidelity of Mis12 multiprotein complex assembly.
20213445 Sgt1 translocates to the nucleus due to heat shock. S100A6 is necessary for nuclear translocation of the Sgt1 protein.
20126976 SUGT1 amplification might give rise to promoting transcription of the gene directly subsequent to the progression of colorectal cancer cases with worsening prognosis
19398558 protein kinase CK2 phosphorylates Ser(361) on Sgt1, and this phosphorylation inhibits Sgt1 dimerization
18358234 Sgt1 is a co-chaperone protein with an expression pattern matching that of the well known heat shock proteins.
17466273 This suggests that the interaction of Sgt1 with Hsp70 and Hsp90 is regulated by S100A6 in a Ca(2+)-dependent manner.
17420470 Multiple lines of evidence show that SGT1 plays an essential role in signaling pathways linked to Nod1 activation in epithelial lineage cells.
15346769 SGt1.2 is a splicing variant of SGT1 and widely expressed in human adult tissue.
12746458 Sgt1 binds to S100A6 in a calcium-regulated manner

AA Sequence

MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKK      1 - 70
SLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQAGLQLLTSSDPPALDSQSAGI     71 - 140
TGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALV    141 - 210
KLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSS    211 - 280
SPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKR    281 - 350
KVEINPPDDMEWKKY                                                           351 - 365
//

Text Mined References (45)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23935490 2013 The Salmonella type III effector SspH2 specifically exploits the NLR co-chaperone activity of SGT1 to subvert immunity.
23440515 2013 SGT1 regulates Akt signaling by promoting beta-TrCP-dependent PHLPP1 degradation in gastric cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184943 2013 Dynamic nucleotide-dependent interactions of cysteine- and histidine-rich domain (CHORD)-containing Hsp90 cochaperones Chp-1 and melusin with cochaperones PP5 and Sgt1.
22869522 2012 Plk1 phosphorylates Sgt1 at the kinetochores to promote timely kinetochore-microtubule attachment.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22623728 2012 Scrib regulates HGF-mediated epithelial morphogenesis and is stabilized by Sgt1-HSP90.
22286152 2013 Hsp90 and its co-chaperone, Sgt1, as autoantigens in dilated cardiomyopathy.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21864708 2011 Nuclear translocation of Sgt1 depends on its phosphorylation state.
21566117 2011 Quantitative mass spectrometry catalogues Salmonella pathogenicity island-2 effectors and identifies their cognate host binding partners.
21269460 2011 Initial characterization of the human central proteome.
20404110 2010 Hsp90-Sgt1 and Skp1 target human Mis12 complexes to ensure efficient formation of kinetochore-microtubule binding sites.
20213445 2011 S100A6 mediates nuclear translocation of Sgt1: a heat shock-regulated protein.
20126976 2010 Overexpression of SUGT1 in human colorectal cancer and its clinicopathological significance.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19398558 2009 Sgt1 dimerization is negatively regulated by protein kinase CK2-mediated phosphorylation at Ser361.
19305138 2009 Sgt1 plays polo during cell division.
18818696 2008 Structural and functional coupling of Hsp90- and Sgt1-centred multi-protein complexes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18358234 2008 Sgt1 has co-chaperone properties and is up-regulated by heat shock.
17466273 2007 Hsp70 is a new target of Sgt1--an interaction modulated by S100A6.
17435760 2007 A crucial function of SGT1 and HSP90 in inflammasome activity links mammalian and plant innate immune responses.
17420470 2007 SGT1 is essential for Nod1 activation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15346769 2004 Molecular cloning and characterization of SGT1.2, a novel splice variant of Homo sapiens SGT1.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15340069 2004 Sgt1 associates with Hsp90: an initial step of assembly of the core kinetochore complex.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15133482 2004 Sgt1 is required for human kinetochore assembly.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15018354 2003 Identification of a novel splice variant: human SGT1B (SUGT1B).
14761955 2004 Human Sgt1 binds HSP90 through the CHORD-Sgt1 domain and not the tetratricopeptide repeat domain.
12746458 2003 Calcium-regulated interaction of Sgt1 with S100A6 (calcyclin) and other S100 proteins.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10445024 1999 SGT1 encodes an essential component of the yeast kinetochore assembly pathway and a novel subunit of the SCF ubiquitin ligase complex.