Property Summary

NCBI Gene PubMed Count 19
PubMed Score 121.99
PubTator Score 76.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 6.8e-07
psoriasis 6685 1.4e-03
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Lipid metabolism disorder 102 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.100 1.4e-03
osteosarcoma -1.858 6.8e-07

Gene RIF (1)

PMID Text
19656773 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEI      1 - 70
TNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPTPSAGKRSLLISRRTGLGLASLP     71 - 140
GPVKSYSHAKQLPVAHRPSVFQSPDEDEEEDYEQWLEIKVSPPEGAETRKVIEKLARFVAEGGPELEKVA    141 - 210
MEDYKDNPAFAFLHDKNSREFLYYRKKVAEIRKEAQKSQAASQKVSPPEDEEVKNLAEKLARFIADGGPE    211 - 280
VETIALQNNRENQAFSFLYEPNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPA    281 - 350
TTCPASSTPAPTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKG    351 - 420
LGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQHGYDSDEEVD    421 - 490
SELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMETFKALKEGREPDYSEYKEFKL    491 - 560
TVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAY    561 - 630
RFRPNPLNNPRRPYY                                                           631 - 645
//

Text Mined References (29)

PMID Year Title
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19656773 2009 A polygenic basis for four classical Fredrickson hyperlipoproteinemia phenotypes that are characterized by hypertriglyceridemia.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12594045 2003 SF4 and SFRS14, two related putative splicing factors on human chromosome 19p13.11.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12176931 2002 Large-scale proteomic analysis of the human spliceosome.