Property Summary

NCBI Gene PubMed Count 19
PubMed Score 121.99
PubTator Score 76.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 6.77986588027114E-7
psoriasis 6685 0.00139712022560777
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Lipid metabolism disorder 102 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.100 0.001
osteosarcoma -1.858 0.000

Synonym

Accession Q8IWZ8 O60378 Q6P3X9 Q8TCQ4 Q8WWT4 Q8WWT5 Q9NTG3
Symbols RBP
SF4
F23858

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
19656773 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEI      1 - 70
TNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPTPSAGKRSLLISRRTGLGLASLP     71 - 140
GPVKSYSHAKQLPVAHRPSVFQSPDEDEEEDYEQWLEIKVSPPEGAETRKVIEKLARFVAEGGPELEKVA    141 - 210
MEDYKDNPAFAFLHDKNSREFLYYRKKVAEIRKEAQKSQAASQKVSPPEDEEVKNLAEKLARFIADGGPE    211 - 280
VETIALQNNRENQAFSFLYEPNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPA    281 - 350
TTCPASSTPAPTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKG    351 - 420
LGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQHGYDSDEEVD    421 - 490
SELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMETFKALKEGREPDYSEYKEFKL    491 - 560
TVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAY    561 - 630
RFRPNPLNNPRRPYY                                                           631 - 645
//

Text Mined References (29)

PMID Year Title
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...