Property Summary

NCBI Gene PubMed Count 17
PubMed Score 58.67
PubTator Score 13.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
nephrosclerosis -1.232 6.2e-03
osteosarcoma 1.416 3.4e-04
adrenocortical carcinoma -1.773 2.3e-06
non-small cell lung cancer 1.353 4.1e-11
lung cancer 1.400 8.1e-04
ulcerative colitis -1.800 2.3e-05
pancreatic cancer 1.200 5.1e-04
Breast cancer 1.400 3.6e-03
invasive ductal carcinoma 1.040 1.1e-04
ovarian cancer 1.100 4.2e-02

Gene RIF (7)

PMID Text
23893049 C7orf10 encodes succinate-hydroxymethylglutarate CoA-transferase, which is the enzyme that converts glutarate to glutaryl-CoA
22277967 Identified as a candidate disease gene for OXPHOS disorders by next-generation sequencing
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18926513 Geneic mapping of GA3 to chromosome 7 and identification of mutations in c7orf10 are reported.

AA Sequence

MPSETHAMLATLARVAALRRTCLFSGRGGGRGLWTGRPQSDMNNIKPLEGVKILDLTRVLAGPFATMNLG      1 - 70
DLGAEVIKVERPGAGDDTRTWGPPFVGTESTYYLSVNRNKKSIAVNIKDPKGVKIIKELAAVCDVFVENY     71 - 140
VPGKLSAMGLGYEDIDEIAPHIIYCSITGYGQTGPISQRAGYDAVASAVSGLMHITGPENGDPVRPGVAM    141 - 210
TDLATGLYAYGAIMAGLIQKYKTGKGLFIDCNLLSSQVACLSHIAANYLIGQKEAKRWGTAHGSIVPYQA    211 - 280
FKTKDGYIVVGAGNNQQFATVCKILDLPELIDNSKYKTNHLRVHNRKELIKILSERFEEELTSKWLYLFE    281 - 350
GSGVPYGPINNMKNVFAEPQVLHNGLVMEMEHPTVGKISVPGPAVRYSKFKMSEARPPPLLGQHTTHILK    351 - 420
EVLRYDDRAIGELLSAGVVDQHETH                                                 421 - 445
//

Text Mined References (17)

PMID Year Title
23893049 2014 C7orf10 encodes succinate-hydroxymethylglutarate CoA-transferase, the enzyme that converts glutarate to glutaryl-CoA.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
22277967 2012 Molecular diagnosis of infantile mitochondrial disease with targeted next-generation sequencing.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
18926513 2008 Genetic mapping of glutaric aciduria, type 3, to chromosome 7 and identification of mutations in c7orf10.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11829489 2002 Molecular genetic studies of human chromosome 7 in Russell-Silver syndrome.
9847074 1998 Toward a complete human genome sequence.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.