Property Summary

NCBI Gene PubMed Count 58
PubMed Score 185.46
PubTator Score 74.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 1.7e-08

Protein-protein Interaction (4)

Gene RIF (36)

PMID Text
26677003 A germline SUFU mutation was present in a patient with MHIBCC, and additional acquired SUFU mutations underlie the development of infundibulocystic basal cell carcinomas
26462018 This study uncovers a previously unappreciated miR-214-Sufu pathway in controlling EMT and metastasis of lung adenocarcinoma.
26067905 SUFU germline polymorphism is associated with acute GVHD
25403219 suggest childhood brain magnetic resonance imaging surveillance is justified in SUFU-related, but not PTCH1-related, Gorlin syndrome
25373737 Sufu has a role in repressing Gli1 transcription and nuclear accumulation, inhibiting glioma cell proliferation, invasion and vasculogenic mimicry, improving glioma chemo-sensitivity and prognosis
24311597 It is demonstrated that GLI binding is associated with major conformational changes in SUFU, including an intrinsically disordered loop that is also crucial for pathway activation.
24217340 The 'closed' form of Sufu is stabilized by Gli binding and inhibited by Hh treatment, whereas the 'open' state of Sufu is promoted by Gli-dissociation and Hh signaling.
24070372 SUFU polymorphisms are associated with neural tube defects in a high-risk population in China.
24018050 Functionally, RIOK3 acts as a SUFU-dependent positive regulator of Hedgehog signaling.
23951062 Data indicate a significant role of hedgehog receptor PTCH1 and SUFU in the pathogenesis of keratocystic odontogenic tumor (KCOT).
23538333 Polymorphisms in the SUFU gene (encoding for a negative regulator of the hedgehog signaling pathway) are associated with protection from Enterobacteriacea bacteremia related organ injury and sepsis severity.
22958902 Our genetic and functional analyses indicate that germline mutations in SUFU also predispose to meningiomas, particularly to multiple meningiomas.
22829011 SUFU germline mutation is associated with nevoid basal cell carcinoma syndrome associated with meningioma.
22666390 mechanism of action on Hedgehog signaling by a suppressor of fused carboxy terminal variant
22508808 germline SUFU mutations are responsible for a high proportion of desmoplastic medulloblastoma in children younger than 3 years of age
22365972 Rab23 directly associates with Su(Fu) and inhibits Gli1 function in a Su(Fu)-dependent manner.
21543335 Glis3 interacts with Suppressor of Fused (SUFU)
21451052 Suppressor of fused transgene negatively regulates hedgehog signaling and proliferation in retinal progenitor cells (RPCs); unexpectedly, Sufu-null RPCs fail to maintain their multipotency, differentiating as amacrine and horizontal neurons.
21317289 Dual Phosphorylation of suppressor of fused (Sufu) by PKA and GSK3beta regulates its stability and localization in the primary cilium.
21210262 We found that hedgehog-interacting protein, PDGFRalpha, smoothened and Su(Fu) gene highly expressed in the primary esophageal squamous cell carcinomas
21209912 ciliary localization of Sufu is dependent on ciliary-localized Gli proteins, and is inhibited by PKA activation
21188540 inactivating germline mutations of SUFU cause ~2-3% of sporadic medulloblastomas and > 10% of desmoplastic medulloblastomas.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19833601 Germline SUFU mutations were identified in two families with several children under 3 years of age diagnosed with medulloblastoma.
19533801 First report of a germ line SUFU mutation associated with Gorlin syndrome.
19432668 Suppressor of fused was overexpressed in endometrial carcinoma compared with the hyperplastic endometrium
19055941 human tumor suppressor SUFU has a role in Hedgehog signaling [review]
19022373 expression induced by 4-Hydroxynonenal,one of several lipid oxidation products, in human leukemia cells, HL-60; this tumor suppressor protein is a target of miR-378
18997815 Shh signaling regulates Sufu activity by inducing its turnover via the ubiquitin-proteasome system.
18829525 A role for SIL in derepressing GLI1 from the negative control of SUFU.
18077375 These results suggest that miR-378 enhances cell survival, tumor growth, and angiogenesis through repression of the expression of two tumor suppressors, Sufu and Fus-1.
16691619 Overexpression of SUFU is associated with Split-hand/split-foot malformation 3
16385451 Observational study of gene-disease association. (HuGE Navigator)
15077159 loss of SUFU function results in overactivity of both the Sonic Hedgehog, and the WNT signaling pathways, leading to excessive proliferation and failure to differentiate resulting in medulloblastomas.
12068298 Mutations in SUFU predispose to medulloblastoma.
11960000 Suppressor of Fused represses Gli-mediated transcription by recruiting the SAP18-mSin3 corepressor complex.

AA Sequence

MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDY      1 - 70
VSMYRNVGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAEL     71 - 140
MQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLTEDPQMQPVQTPFGVVTFLQIVGVCTEELHS    141 - 210
AQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSR    211 - 280
PPEDDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESD    281 - 350
SSTAIIPHELIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATE    351 - 420
EHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFDSPLH          421 - 484
//

Text Mined References (62)

PMID Year Title
26677003 2016 Multiple Hereditary Infundibulocystic Basal Cell Carcinoma Syndrome Associated With a Germline SUFU Mutation.
26462018 2015 microRNA-214 promotes epithelial-mesenchymal transition and metastasis in lung adenocarcinoma by targeting the suppressor-of-fused protein (Sufu).
26067905 2015 Genome-wide single-nucleotide polymorphism analysis revealed SUFU suppression of acute graft-versus-host disease through downregulation of HLA-DR expression in recipient dendritic cells.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25403219 2014 Germline mutations in SUFU cause Gorlin syndrome-associated childhood medulloblastoma and redefine the risk associated with PTCH1 mutations.
25373737 2014 Suppressor of fused (Sufu) represses Gli1 transcription and nuclear accumulation, inhibits glioma cell proliferation, invasion and vasculogenic mimicry, improving glioma chemo-sensitivity and prognosis.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24311597 2013 Structural basis of SUFU-GLI interaction in human Hedgehog signalling regulation.
24217340 2013 Structural insight into the mutual recognition and regulation between Suppressor of Fused and Gli/Ci.
24070372 2014 An association study between SUFU gene polymorphisms and neural tube defects.
24018050 2013 RIO kinase 3 acts as a SUFU-dependent positive regulator of Hedgehog signaling.
23951062 2013 Integrated genotypic analysis of hedgehog-related genes identifies subgroups of keratocystic odontogenic tumor with distinct clinicopathological features.
23538333 2013 Polymorphisms in the SUFU gene are associated with organ injury protection and sepsis severity in patients with Enterobacteriacea bacteremia.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22958902 2012 Loss of SUFU function in familial multiple meningioma.
22829011 2012 Two cases of nevoid basal cell carcinoma syndrome associated with meningioma caused by a PTCH1 or SUFU germline mutation.
22666390 2012 Novel mechanism of action on Hedgehog signaling by a suppressor of fused carboxy terminal variant.
22508808 2012 High frequency of germline SUFU mutations in children with desmoplastic/nodular medulloblastoma younger than 3 years of age.
22439934 2012 The crosstalk of mTOR/S6K1 and Hedgehog pathways.
22365972 2012 Rab23 negatively regulates Gli1 transcriptional factor in a Su(Fu)-dependent manner.
21543335 2011 Modulation of the transactivation function and stability of Krüppel-like zinc finger protein Gli-similar 3 (Glis3) by Suppressor of Fused.
21451052 2011 Suppressor of fused is required to maintain the multipotency of neural progenitor cells in the retina.
21317289 2011 Dual Phosphorylation of suppressor of fused (Sufu) by PKA and GSK3beta regulates its stability and localization in the primary cilium.
21269460 2011 Initial characterization of the human central proteome.
21210262 2011 Identification of signature genes for detecting hedgehog pathway activation in esophageal cancer.
21209912 2010 Coordinated translocation of mammalian Gli proteins and suppressor of fused to the primary cilium.
21188540 2011 Heterogeneity of familial medulloblastoma and contribution of germline PTCH1 and SUFU mutations to sporadic medulloblastoma.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20643644 2010 Dual function of UNC-51-like kinase 3 (Ulk3) in the Sonic hedgehog signaling pathway.
19833601 2010 Incomplete penetrance of the predisposition to medulloblastoma associated with germ-line SUFU mutations.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19533801 2009 Identification of a SUFU germline mutation in a family with Gorlin syndrome.
19432668 2009 Expression of sonic hedgehog signaling molecules in normal, hyperplastic and carcinomatous endometrium.
19055941 2008 Role and regulation of human tumor suppressor SUFU in Hedgehog signaling.
19022373 2009 MicroRNA expression changes during human leukemic HL-60 cell differentiation induced by 4-hydroxynonenal, a product of lipid peroxidation.
18997815 2009 Hedgehog signaling promotes the degradation of tumor suppressor Sufu through the ubiquitin-proteasome pathway.
18829525 2008 SCL/TAL1 interrupting locus derepresses GLI1 from the negative control of suppressor-of-fused in pancreatic cancer cell.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18077375 2007 MicroRNA-378 promotes cell survival, tumor growth, and angiogenesis by targeting SuFu and Fus-1 expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16691619 2006 Split-hand/split-foot malformation 3 (SHFM3) at 10q24, development of rapid diagnostic methods and gene expression from the region.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15367681 2004 Suppressor of fused regulates Gli activity through a dual binding mechanism.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15077159 2004 Failure of a medulloblastoma-derived mutant of SUFU to suppress WNT signaling.
14611647 2004 The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426310 2003 Characterization of the physical interaction of Gli proteins with SUFU proteins.
12068298 2002 Mutations in SUFU predispose to medulloblastoma.
11960000 2002 Suppressor of Fused represses Gli-mediated transcription by recruiting the SAP18-mSin3 corepressor complex.
11252182 1999 The Suppressor of fused gene, involved in Hedgehog signal transduction in Drosophila, is conserved in mammals.
11001584 2000 The sonic hedgehog-patched-gli pathway in human development and disease.
10806483 2000 Gli regulation by the opposing activities of fused and suppressor of fused.
10564661 1999 Characterization of the human suppressor of fused, a negative regulator of the zinc-finger transcription factor Gli.
10559945 1999 Mammalian suppressor-of-fused modulates nuclear-cytoplasmic shuttling of Gli-1.