Property Summary

NCBI Gene PubMed Count 17
PubMed Score 36.87
PubTator Score 14.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.021 2.1e-02
osteosarcoma -3.715 2.9e-10
ovarian cancer 2.300 4.5e-04

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MSAAGLLAPAPAQAGAPPAPEYYPEEDEELESAEDDERSCRGRESDEDTEDASETDLAKHDEEDYVEMKE      1 - 70
QMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLETEQVERNYIKEKKAAVKEFE     71 - 140
DKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYL    141 - 210
LTDEQIMEDLRTLNKLKSPKRPASPSSPEHLPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESK    211 - 280
DNQKLSCVISSVGANEIWVRKTSDSTKMRIYLGQLQRGLFVIRRRSAA                          281 - 328
//

Text Mined References (28)

PMID Year Title