Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.79
PubTator Score 6.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.200 1.1e-02
invasive ductal carcinoma 1.200 4.6e-04
ovarian cancer 1.600 9.0e-06
posterior fossa group B ependymoma 1.100 1.7e-05
tuberculosis 1.100 2.1e-04

Gene RIF (5)

AA Sequence

MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLEC      1 - 70
VKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHF     71 - 140
LRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLH    141 - 210
IRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCK    211 - 280
NNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY                                         281 - 313
//

Text Mined References (14)

PMID Year Title