Property Summary

NCBI Gene PubMed Count 24
PubMed Score 198.83
PubTator Score 133.97

Knowledge Summary

Patent (5,331)

Expression

  Differential Expression (27)

Disease log2 FC p
gastric cancer 2.000 7.7e-04
malignant mesothelioma 2.200 6.3e-08
astrocytic glioma -3.400 4.9e-03
ependymoma -4.100 3.9e-16
oligodendroglioma -3.200 1.1e-02
psoriasis 2.300 4.5e-04
glioblastoma -4.700 3.9e-05
osteosarcoma -3.936 5.0e-09
medulloblastoma -5.100 3.2e-08
atypical teratoid / rhabdoid tumor -4.900 1.2e-08
medulloblastoma, large-cell -5.200 1.1e-03
primitive neuroectodermal tumor -4.600 1.3e-03
Atopic dermatitis 1.100 2.7e-03
non-small cell lung cancer 1.223 4.8e-10
intraductal papillary-mucinous adenoma (... 4.900 9.4e-05
intraductal papillary-mucinous carcinoma... 4.000 1.7e-03
colon cancer -1.400 3.9e-02
pancreatic cancer 2.500 7.1e-08
fibroadenoma 1.100 5.8e-03
interstitial cystitis -1.600 3.7e-03
lung adenocarcinoma 1.700 2.7e-08
adult high grade glioma -3.900 9.4e-04
pilocytic astrocytoma -4.100 9.2e-07
spina bifida -2.958 3.4e-02
Pick disease -1.200 7.2e-04
pituitary cancer -1.900 3.8e-04
facioscapulohumeral dystrophy -1.600 4.5e-02

Gene RIF (16)

PMID Text
27012048 NOK expression increased in renal cell carcinoma and was significantly correlated with TNM stage, Fuhrman grade, poor overall survival, poor disease-free survival, metastasis, and proliferation.
25961552 The data indicates that both P203 and V395 residues on NOK are important for NOK mediated mitogenic signaling.
25884558 increased STYK1 protein expression correlates with disease progression and metastasis and may serve as a predictor of poor survival in CRC.
25190507 These results suggest that STYK1 is a novel drug resistance factor and could be a predictor of the therapeutic response in acute leukemia.
25169509 STYK1/NOK is dramatically upregulated in colorectal cancer tissues and could be used as a tumor marker. Furthermore, the high expression of STYK1/NOK is significantly associated with tumor size.
24894011 Our results indicate that NOK expression is of clinical significance and can serve as a prognostic biomarker in non-small cell lung cancer.
23010592 The expression levels of NOK, p-Akt(Thr308) and p-GSK-3beta(Ser9) were positively correlated in cancerous and non-cancerous breast cell lines.
22516751 Taken together, NOK has a strong tendency towards forming aggregates, which may have physiological implications and provide the first evidence that this novel receptor kinase is colocalised with EGFR in endosomes to participate in a post-internalisation step of EGFR.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19664042 Overexpression of the potential kinase serine/ threonine/tyrosine kinase 1 (STYK 1) in castration-resistant prostate cancer.
19464057 Observational study of gene-disease association. (HuGE Navigator)
19409952 results indicate that STYK1/NOK mRNA is widely expressed in the patients with acute leukemia and suggest that inhibition of this molecule could potentially serve as a novel therapeutic target
17415682 The regulation of STYK1/NOK is achieved independent of ERalpha and suggests further investigation to the relevance of this kinase in breast cancer progression.
17298854 NOK mRNA was highly expressed even at the early clinical stages of the cancer. These results suggest that NOK mRNA might be a new tool to support the diagnosis of lung cancers, irrespective of the clinical stages.
12841579 cloning and characterization; mapped to chromosome 12p13; widely expressed in human tissues
12471243 SuRTK106/NOK/STYK1 was first identified, classified and shown to have predicted pseudokinase domain.

AA Sequence

MGMTRMLLECSLSDKLCVIQEKQYEVIIVPTLLVTIFLILLGVILWLFIREQRTQQQRSGPQGIAPVPPP      1 - 70
RDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSK     71 - 140
PKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYMVLEDVAQGDLLSFLWTCR    141 - 210
RDVMTMDGLLYDLTEKQVYHIGKQVLLALEFLQEKHLFHGDVAARNILMQSDLTAKLCGLGLAYEVYTRG    211 - 280
AISSTQTIPLKWLAPERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIMKRPSS    281 - 350
CTHTMYSIMKSCWRWREADRPSPRELRLRLEAAIKTADDEAVLQVPELVVPELYAAVAGIRVESLFYNYS    351 - 420
ML                                                                        421 - 422
//

Text Mined References (28)

PMID Year Title
27012048 2016 High Novel Oncogene with Kinase-Domain (NOK) Gene Expression is Associated with the Progression of Renal Cell Carcinoma.
25961552 2015 NOK mediated mitogenic signaling is altered by P203L and V395I mutations.
25884558 2015 Serine threonine tyrosine kinase 1 is a potential prognostic marker in colorectal cancer.
25190507 2014 Significance of serine threonine tyrosine kinase 1 as a drug resistance factor and therapeutic predictor in acute leukemia.
25169509 2014 Diagnostic relevance of overexpressed serine threonine tyrosine kinase/novel oncogene with kinase domain (STYK1/ NOK) mRNA in colorectal cancer.
24894011 2014 Clinicopathologic features and prognostic implications of NOK/STYK1 protein expression in non-small cell lung cancer.
23010592 2012 NOK/STYK1 interacts with GSK-3? and mediates Ser9 phosphorylation through activated Akt.
22516751 2012 NOK/STYK1 has a strong tendency towards forming aggregates and colocalises with epidermal growth factor receptor in endosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19664042 2009 Overexpression of the potential kinase serine/ threonine/tyrosine kinase 1 (STYK 1) in castration-resistant prostate cancer.
19464057 2009 A high-throughput candidate gene mutation screen in lymphoproliferative and myeloproliferative neoplasias.
19409952 2009 Overexpression of serine threonine tyrosine kinase 1/novel oncogene with kinase domain mRNA in patients with acute leukemia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17415682 2008 A novel gene STYK1/NOK is upregulated in estrogen receptor-alpha negative estrogen receptor-beta positive breast cancer cells following estrogen treatment.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17298854 2007 Diagnostic relevance of overexpressed mRNA of novel oncogene with kinase-domain (NOK) in lung cancers.
16541075 2006 The finished DNA sequence of human chromosome 12.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15150103 2004 A novel protein tyrosine kinase NOK that shares homology with platelet- derived growth factor/fibroblast growth factor receptors induces tumorigenesis and metastasis in nude mice.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12841579 2003 Isolation and characterization of a human putative receptor protein kinase cDNA STYK1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471243 2002 The protein kinase complement of the human genome.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.