Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.99
PubTator Score 6.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Breast cancer 3469 0.0 3.0

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 5.6e-06
atypical teratoid / rhabdoid tumor 1.300 4.9e-05
ependymoma 1.100 5.2e-08
group 3 medulloblastoma 1.200 4.3e-04
primitive neuroectodermal tumor 1.300 5.1e-04

Gene RIF (7)

AA Sequence

MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVYIQEIIPGGDCYKDGRLKPGDQL      1 - 70
VSVNKESMIGVSFEEAKSIITGAKLRLESAWEIAFIRQKSDNIQPENLSCTSLIEASGEYGPQASTLSLF     71 - 140
SSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPITSENSTVGLSNTDVASAWTENYGLQEKISLN    141 - 210
PSVRFKAEKLEMALNYLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDEVNVGAHEISN    211 - 280
ILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALR    281 - 350
SRIHLAEAAQRQAHGMEMDYEEVIRLLEAKITELKAQLADYSDQNKESVQDLKKRIMVLDCQLRKSEMAR    351 - 420
KTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGRSIPATLALESKELVKSVR    421 - 490
ALLDMDCLPYGWEEAYTADGIKYFINHVTQTTSWIHPVMSVLNLSRSEENEEDCSRELPNQKS           491 - 553
//

Text Mined References (22)

PMID Year Title