Property Summary

NCBI Gene PubMed Count 40
PubMed Score 20.52
PubTator Score 23.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma -1.100 9.1e-04
intraductal papillary-mucinous adenoma (... 1.200 1.0e-02
invasive ductal carcinoma -1.100 3.6e-03
lung cancer 1.400 1.1e-02
medulloblastoma, large-cell -2.200 3.9e-06
non-small cell lung cancer -1.072 2.7e-20
osteosarcoma -1.891 6.1e-05
ovarian cancer -1.600 2.4e-07
psoriasis -1.200 8.5e-04

Gene RIF (8)

AA Sequence

MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYI      1 - 70
KEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKER     71 - 140
NLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQGDVIDSIEANV    141 - 210
ENAEVHVQQANQQLSRAADYQRKSRKTLCIIILILVIGVAIISLIIWGLNH                       211 - 261
//

Text Mined References (50)

PMID Year Title