Property Summary

NCBI Gene PubMed Count 40
PubMed Score 53.66
PubTator Score 46.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.900 8.3e-08
psoriasis 1.200 6.3e-04
osteosarcoma -2.533 3.0e-07
medulloblastoma, large-cell 2.400 3.8e-06
intraductal papillary-mucinous neoplasm ... 1.100 9.6e-03
group 3 medulloblastoma 2.500 2.9e-05
spina bifida -1.572 2.2e-02
Pick disease -1.100 2.8e-05
ductal carcinoma in situ 1.300 4.8e-04
invasive ductal carcinoma 1.900 1.1e-04
ulcerative colitis -1.700 1.6e-06
pituitary cancer 1.700 2.4e-03
axial spondyloarthropathy 1.100 4.6e-02

Gene RIF (17)

PMID Text
26553929 GLUT5 required an interaction cascade of Rab11, Myo5B, Slp4a, Munc18-2, and Vamp7 with Stx3.
25673875 Rab11a-knockdown cells displayed mislocalization of STX3 and the presentation of microvilli in the basolateral compartment
25630102 The results showed that there was reduction in aggregation propensity of syntaxin-3 with point mutation at Val286.
25583387 hcmv-miR-US33-5p-mediated inhibition of HCMV DNA synthesis and of viral replication are specifically mediated by down-regulation of STX3 expression.
25548252 the secretion of IL-1alpha, IL-1beta, IL-12b, and CCL4 occurs during gelatinase degranulation, a process controlled by STX3.
25358429 we report for the first time a missense mutation of a novel lens specific gene STX3 in a phenotype associating autosomal recessive congenital cataract and intellectual disability.
24726755 loss of STX3 function causes variant microvillus inclusion disease
24171760 syntaxin3 has a latent prosurvival function and is involved in maintenance of homeostasis in epidermal keratinocytes
23132338 In insulin secretion, SYN-3 plays a role in the mediation of newcomer SG exocytosis and SG-SG fusion that contributes to biphasic GSIS.
21981832 STX-3 and SNAP-23 are crucial for the release of all chemokines in mature human mast cells
21720706 siRNA knockdown (KD) of syntaxins 3 and 4 in HeLa cells reduced cell surface expression of alpha5beta1 and alpha3beta1 integrins
21371234 These results demonstrate a function for STX3 in human cytomegalovirus morphogenesis, and unravel a new role for this SNARE protein in late endosomes/lysosomes compartments.
20844248 syntaxin 3 interacts with CFTR in vivo.
20695848 Munc18b is functionally coupled to the assembly of exocytic SNARE complexes and increases exocytosis by interacting with the N-peptide and closed-conformation C-terminus of Stx3, thereby neutralizing the secretion-inhibitory effect of this SNARE.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19815536 Data show that the BCG phagosome is relatively depleted in LAMP-2, NPC1, flotillin-1, vATPase, and syntaxin 3.
12198139 Munc18b binds to syntaxins 1A, 2, and 3 and regulates vesicle transport to the apical plasma membrane

AA Sequence

MKDRLEQLKAKQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPE      1 - 70
PKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD     71 - 140
FRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKE    141 - 210
LHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKKAVKYQSQARKKLIIIIVLVVVLLGILAL    211 - 280
IIGLSVGLN                                                                 281 - 289
//

Text Mined References (43)

PMID Year Title
26553929 2015 Cargo-selective apical exocytosis in epithelial cells is conducted by Myo5B, Slp4a, Vamp7, and Syntaxin 3.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25673875 2015 Rab11a regulates syntaxin 3 localization and microvillus assembly in enterocytes.
25630102 2014 Effect of mutation on aggregation propensity in homology model structures of syntaxin-3 from Homo sapiens.
25583387 2015 Human cytomegalovirus miR-US33-5p inhibits viral DNA synthesis and viral replication by down-regulating expression of the host Syntaxin3.
25548252 2015 An essential role of syntaxin 3 protein for granule exocytosis and secretion of IL-1?, IL-1?, IL-12b, and CCL4 from differentiated HL-60 cells.
25416956 2014 A proteome-scale map of the human interactome network.
25358429 2015 Autosomal recessive congenital cataract, intellectual disability phenotype linked to STX3 in a consanguineous Tunisian family.
24726755 2014 Loss of syntaxin 3 causes variant microvillus inclusion disease.
24171760 2013 Effluent syntaxin3 from dying cells affords protection against apoptosis in epidermal keratinocytes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23132338 2013 Syntaxin-3 regulates newcomer insulin granule exocytosis and compound fusion in pancreatic beta cells.
21981832 2011 SNAP-23 and syntaxin-3 are required for chemokine release by mature human mast cells.
21720706 2011 Syntaxins 3 and 4 mediate vesicular trafficking of ?5?1 and ?3?1 integrins and cancer cell migration.
21371234 2011 A role for the SNARE protein syntaxin 3 in human cytomegalovirus morphogenesis.
21269460 2011 Initial characterization of the human central proteome.
20844248 2010 Syntaxin 3 is necessary for cAMP- and cGMP-regulated exocytosis of CFTR: implications for enterotoxigenic diarrhea.
20695848 2010 Munc18b regulates core SNARE complex assembly and constitutive exocytosis by interacting with the N-peptide and the closed-conformation C-terminus of syntaxin 3.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19815536 2010 The Mycobacterium bovis bacille Calmette-Guerin phagosome proteome.
19515809 2009 Syntaxin specificity of aquaporins in the inner medullary collecting duct.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18588921 2008 Involvement of Munc18 isoforms in the regulation of granule exocytosis in neutrophils.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17041090 2006 Differing effects of microtubule depolymerizing and stabilizing chemotherapeutic agents on t-SNARE-mediated apical targeting of prostate-specific membrane antigen.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16551573 2006 AROS-29 is involved in adaptive response to oxidative stress.
16339081 2006 Syntaxins 3 and 4 are concentrated in separate clusters on the plasma membrane before the establishment of cell polarity.
15576373 2005 Protease-activated receptor-1 activation of endothelial cells induces protein kinase Calpha-dependent phosphorylation of syntaxin 4 and Munc18c: role in signaling p-selectin expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12545172 2003 Three-dimensional analysis of post-Golgi carrier exocytosis in epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198139 2002 Analysis of the Munc18b-syntaxin binding interface. Use of a mutant Munc18b to dissect the functions of syntaxins 2 and 3.
11487543 2001 Intestinal epithelial cells secrete exosome-like vesicles.
11003604 2000 Transport and function of syntaxin 3 in human epithelial intestinal cells.
10788461 2000 Munc18-2, a functional partner of syntaxin 3, controls apical membrane trafficking in epithelial cells.
10080545 1999 Co-expression of several human syntaxin genes in neutrophils and differentiating HL-60 cells: variant isoforms and detection of syntaxin 1.
9852078 1998 Three novel proteins of the syntaxin/SNAP-25 family.
9701566 1998 Interaction of Munc-18-2 with syntaxin 3 controls the association of apical SNAREs in epithelial cells.
9614185 1998 A novel tetanus neurotoxin-insensitive vesicle-associated membrane protein in SNARE complexes of the apical plasma membrane of epithelial cells.
9378770 1997 Human syntaxin 3 is localized apically in human intestinal cells.