Property Summary

NCBI Gene PubMed Count 35
PubMed Score 834.22
PubTator Score 259.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.300 1.6e-02
tuberculosis 1.200 5.7e-06
group 3 medulloblastoma 1.200 2.6e-04
ovarian cancer -2.500 3.5e-16

Synonym

Accession P32856 Q86VW8
Symbols EPM
EPIM
STX2A
STX2B
STX2C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

PMID Text
24578379 Identify 3 loci associated with circulating tPA levels, the PLAT region, STXBP5, and STX2. Functional studies implicate a novel role for STXBP5 and STX2 in regulating tPA release.
24039787 Epimorphin can revert ovarian cancer cells away from their mesenchymal phenotype and toward an epithelial phenotype.
23219092 epimorphin modulates the signaling pathways mediated by EGFR for epidermal tissue organization
22792389 Genetic variation in STX2 is associated with von Willebrand factor:Ag levels in patients diagnosed with type 1 von Willebrand Disease.
22045676 EPM, secreted by activated stellate cells within stroma, promotes invasion and metastasis of hepatocellular cancer cells by activating MMP-9 expression through the FAK-ERK pathway.
21156930 Genetic variability in STXBP5 and STX2 affects both VWF concentration and activity in young individuals with premature arterial thrombosis.
19129200 Homology with vesicle fusion mediator syntaxin-1a predicts determinants of epimorphin/syntaxin-2 function in mammary epithelial morphogenesis.(
18273050 Inadequate epimorphin elicits an abnormal differentiation response in keratinocytes, and indicate a causal function of the epimorphin signaling gradient for the establishment of differentiated epidermal structure in the skin.
17485553 expression of SNAP-23 and syntaxin-2 on the extracellular surface of the platelet plasma membrane.
15651999 These findings suggest that epimorphin contributes to repair of pulmonary fibrosis in nonspecific interstitial pneumonia, perhaps partly by inducing expression of matrix metalloproteinase 2, which is an important proteolytic factor in lung remodeling.
12198139 Munc18b binds to syntaxins 1A, 2, and 3 and regulates vesicle transport to the apical plasma membrane

AA Sequence

MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKI      1 - 70
KEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLF     71 - 140
RERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRE    141 - 210
LHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIAL    211 - 280
IIGLSVGK                                                                  281 - 288
//

Text Mined References (36)

PMID Year Title
24578379 2014 Genome-wide association study for circulating tissue plasminogen activator levels and functional follow-up implicates endothelial STXBP5 and STX2.
24039787 2013 Epimorphin-induced MET sensitizes ovarian cancer cells to platinum.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23219092 2013 Extracellular epimorphin modulates epidermal differentiation signals mediated by epidermal growth factor receptor.
22792389 2012 Effect of genetic variation in STXBP5 and STX2 on von Willebrand factor and bleeding phenotype in type 1 von Willebrand disease patients.
22226963 2012 The impact of extracellular syntaxin4 on HaCaT keratinocyte behavior.
22045676 2011 Epimorphin promotes human hepatocellular carcinoma invasion and metastasis through activation of focal adhesion kinase/extracellular signal-regulated kinase/matrix metalloproteinase-9 axis.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
21720706 2011 Syntaxins 3 and 4 mediate vesicular trafficking of ?5?1 and ?3?1 integrins and cancer cell migration.
21156930 2010 Effect of genetic variations in syntaxin-binding protein-5 and syntaxin-2 on von Willebrand factor concentration and cardiovascular risk.
19129200 2009 Homology with vesicle fusion mediator syntaxin-1a predicts determinants of epimorphin/syntaxin-2 function in mammary epithelial morphogenesis.
18273050 2008 Overexpression of extracellular epimorphin leads to impaired epidermal differentiation in HaCaT keratinocytes.
17485553 2007 SNAP-23 and syntaxin-2 localize to the extracellular surface of the platelet plasma membrane.
16541075 2006 The finished DNA sequence of human chromosome 12.
16339081 2006 Syntaxins 3 and 4 are concentrated in separate clusters on the plasma membrane before the establishment of cell polarity.
15943887 2005 Localization of plasma membrane t-SNAREs syntaxin 2 and 3 in intracellular compartments.
15651999 2005 Epimorphin expression in interstitial pneumonia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12773094 2003 A role for Sec1/Munc18 proteins in platelet exocytosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198139 2002 Analysis of the Munc18b-syntaxin binding interface. Use of a mutant Munc18b to dissect the functions of syntaxins 2 and 3.
10777504 2000 Selective interaction of complexin with the neuronal SNARE complex. Determination of the binding regions.
10397765 1999 Functional and biochemical analysis of the C2 domains of synaptotagmin IV.
9425164 1998 Epimorphin functions as a key morphoregulator for mammary epithelial cells.
9177305 1997 Identification of cellular recognition sequence of epimorphin and critical role of cell/epimorphin interaction in lung branching morphogenesis.
9110174 1997 Large-scale concatenation cDNA sequencing.
9045631 1997 Characterization of Munc-18c and syntaxin-4 in 3T3-L1 adipocytes. Putative role in insulin-dependent movement of GLUT-4.
8999968 1997 Direct interaction of the rat unc-13 homologue Munc13-1 with the N terminus of syntaxin.
8938452 1996 The epimorphin gene is highly conserved among humans, mice, and rats and maps to human chromosome 7, mouse chromosome 5, and rat chromosome 12.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8549663 1996 Inductive influences of epimorphin on endothelial cells in vitro.
8466509 1993 Molecular cloning of human epimorphin: identification of isoforms and their unique properties.
7791877 1995 Ca(2+)-dependent and -independent activities of neural and non-neural synaptotagmins.
7768895 1995 A novel ubiquitous form of Munc-18 interacts with multiple syntaxins. Use of the yeast two-hybrid system to study interactions between proteins involved in membrane traffic.
1581962 1992 Epimorphin: a mesenchymal protein essential for epithelial morphogenesis.