Property Summary

NCBI Gene PubMed Count 37
PubMed Score 902.65
PubTator Score 259.08

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.300 1.6e-02
group 3 medulloblastoma 1.200 2.6e-04
ovarian cancer -2.500 3.5e-16
tuberculosis 1.200 5.7e-06

Gene RIF (13)

AA Sequence

MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKI      1 - 70
KEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLF     71 - 140
RERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRE    141 - 210
LHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIAL    211 - 280
IIGLSVGK                                                                  281 - 288
//

Text Mined References (38)

PMID Year Title